Details for Kale Locus Bo5g137910

Position : C5 ( 5`- 43087267 .. 43088324 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137910

Protein [Map View]
MAVPREVNAMEQNNVDCDIAVEYEFSSLLGALAAAAEFGDVVALGTAIDTMHGFTDEPLENNDTALHLACLYGNLPCVEL
LLERGADMEVKDLYRATPLHNACDGGYLDIVEFLLSRASGPECAKRMIETIDQQGDTPLHNAARGEYVDVVRLLLSSGAS
PTTKNSSGKTPGDLAGINSEARRILEVAVGNSSIS*

DNA
ATGGCCGTTCCAAGGGAAGTCAATGCGATGGAACAAAACAATGTTGACTGTGATATTGCTGTTGAATACGAGTTTTCCTC
GCTTCTCGGTGCCTTAGCCGCCGCAGCTGAGTTCGGTGACGTCGTCGCCTTGGGCACAGCCATTGACACTATGCATGGGT
TTACTGACGAGCCACTTGAGAATAATGACACGGCACTTCACTTGGCGTGTCTATATGGTAACCTCCCTTGTGTTGAGCTT
CTCCTGGAAAGAGGAGCTGATATGGAGGTTAAAGATTTATATAGAGCAACTCCTCTACATAATGCTTGCGATGGGGGATA
CTTAGACATAGTAGAGTTTCTTTTAAGCCGAGCTAGTGGTCCTGAATGTGCGAAGAGAATGATTGAAACAATCGACCAAC
AAGGTGACACTCCTCTGCATAATGCAGCGAGAGGTGAGTATGTCGATGTGGTTAGGCTTTTGCTAAGTTCAGGGGCTTCA
CCAACGACTAAAAACTCCAGCGGGAAGACACCAGGTGATTTAGCTGGTATAAACAGTGAGGCTAGGAGGATCCTCGAAGT
TGCGGTTGGCAACTCATCAATCTCCTAG