Details for Kale Locus Bo5g137900

Position : C5 ( 5`- 43084940 .. 43086478 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137900

Protein [Map View]
MAAAPGRARSDYDYLVKLLLIGDSGVGKSCLLLRFSDDTFTTSFITTIGIDFKIRTVELDGKRIKLQIWDTAGQERFRTI
TTAYYRGAMGILLVYDVTDESSFNNIRNWMKNIEQHASDSVNRILVGNKADMDESKRAIPTSKGQALADEYGIKFFETSA
KTNLNVEQVFMSIAKDIKQRLTESDTKSEPQGLKIKKQDANKASSSSTAGKSACCSYA*

DNA
ATGGCGGCTGCGCCGGGAAGAGCTCGTTCAGACTATGATTACCTCGTCAAGCTCCTCCTAATCGGTGATAGCGGTGTGGG
AAAAAGTTGCTTGCTGCTGCGTTTCTCTGATGATACTTTCACCACAAGTTTCATTACTACCATTGGAATTGATTTCAAGA
TAAGAACAGTTGAACTTGATGGGAAGCGTATCAAATTGCAGATATGGGACACCGCTGGACAAGAACGTTTTCGAACTATA
ACTACAGCTTATTACAGAGGAGCAATGGGTATATTACTCGTCTACGATGTAACAGACGAGTCATCCTTCAACAACATTAG
GAACTGGATGAAGAATATTGAGCAACATGCTTCAGATAGCGTCAACAGAATATTGGTTGGTAACAAAGCTGACATGGACG
AAAGCAAAAGGGCCATCCCAACATCAAAGGGACAAGCTCTGGCTGATGAGTATGGAATCAAGTTCTTCGAGACGAGTGCA
AAAACAAACCTGAATGTGGAGCAGGTTTTCATGTCTATTGCGAAAGACATCAAACAAAGACTCACAGAAAGCGATACAAA
GTCTGAGCCCCAAGGGCTCAAGATCAAAAAACAAGATGCTAACAAAGCCTCTTCGTCTTCTACAGCTGGAAAATCAGCTT
GCTGCAGTTATGCTTAG