Details for Kale Locus Bo5g137880

Position : C5 ( 5`- 43079160 .. 43082547 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137880

Protein [Map View]
MSDIEVGGGGGPVAFAERTKSVDALTKKEILSALTNGEITSEPSEDARFRNRELSLPNGESYDGTLLGNIPEGPGKYAWS
DGSVYVGEWRRGMRHGNGKMRWASGACYEGEFSGGYMHGTGTCTDANSLTYKGRWRLNLKHGLGYQVYPNGDVLEGSWIQ
GWGEGPGKYTWGNGNIYLGDMKGGKMSGKGTLTWITGDSYEGSWLNGMMHGFGVYTWRDGGCYVGTWTRGLKDGKGSFYS
AGTRVPAVQEFYLNALRKRGVLPDLRRQSQVAAASSVNMESLRVGGGGNNKLSKGSLINLEQSRNGRVSLERRWSLEVSI
EKVIGHDYSDLDRGSSTEEYSANRPILEREYMQGVLISERVVVDNRFSPTSKRAKRKNKRLFKEAKKPGEVVIKGHRSYD
LMLSLQLGIRYTVGKITPIQRREVRTADFGPRASFWMSFPRAGSAMTPPHHSEDFKWKDYCPMVFRNLREMFKMDSADYM
MSICGNDTLRELSSPGKSGSVFFLSQDDRFMIKTLRKSEVKVLLRMLPYYHHHVKTYENTLITKFFGLHRIKPSSGQKFR
FVVMGNMFFTDLRIHRRFDLKGSKLGRSADKVEIDENTILKDLDLNYSFFLEPSWREGLLKQLEIDSKFLVEQNIMDYSL
LLGVHHRAPEHLRTQLVRSRSITADALESVAEDDTIEDDMLSYHQGLVLVPGGSDNVVTGPHIRGSRLRASAVGDEEVDL
LLPGTARLQIQQGVNMPARAELIPGTEEKDRQILHDCCDVVLYLGIIDILQEYNMTKKIEHAYKSLHFDSKSISAVDPTY
YSQRFLDFIEKVFPQNNA*

DNA
ATGTCTGACATTGAAGTGGGAGGAGGAGGAGGACCAGTTGCATTCGCAGAAAGAACCAAATCCGTTGATGCACTCACCAA
GAAAGAGATACTCTCCGCTCTAACCAACGGAGAGATCACCTCCGAACCTTCCGAGGACGCTAGGTTCAGAAACAGGGAGC
TCTCCCTCCCCAACGGCGAGTCCTACGACGGCACTCTCCTCGGAAACATCCCCGAGGGCCCAGGGAAGTACGCGTGGTCA
GACGGCTCCGTTTACGTCGGCGAATGGAGACGCGGGATGAGACACGGCAACGGGAAGATGAGATGGGCTTCGGGCGCGTG
CTACGAAGGCGAGTTCTCAGGAGGGTACATGCACGGCACGGGGACGTGCACGGACGCTAACAGCTTAACGTATAAAGGAA
GGTGGCGGCTGAATCTCAAACACGGGCTTGGGTATCAAGTTTACCCTAACGGAGACGTCTTAGAAGGCTCTTGGATTCAG
GGTTGGGGAGAAGGGCCAGGGAAGTACACTTGGGGCAATGGGAATATCTATCTTGGGGATATGAAAGGTGGGAAGATGAG
TGGGAAAGGGACGTTGACTTGGATCACTGGGGACTCTTATGAAGGGAGTTGGTTGAATGGGATGATGCATGGTTTCGGTG
TGTACACGTGGAGGGACGGTGGTTGCTACGTAGGGACGTGGACGCGTGGTTTGAAAGATGGGAAAGGATCGTTTTACTCG
GCAGGGACTAGAGTTCCCGCCGTGCAGGAGTTTTATCTCAACGCTCTTAGGAAAAGAGGCGTGTTGCCTGATCTGAGGAG
GCAGAGCCAAGTTGCTGCAGCTTCTTCGGTTAATATGGAGAGTCTTAGAGTCGGTGGTGGTGGCAACAACAAGCTCTCGA
AAGGGAGTTTGATTAACTTGGAGCAGTCACGCAACGGGAGGGTTTCTTTGGAGAGGCGGTGGAGTCTTGAAGTGAGTATT
GAGAAAGTGATTGGGCATGATTACTCGGATTTGGATAGGGGAAGCAGTACTGAGGAGTATAGTGCGAACAGACCGATCTT
GGAACGGGAGTATATGCAGGGTGTTCTGATCAGTGAGCGTGTGGTGGTAGACAACAGGTTTTCGCCTACTTCGAAAAGAG
CTAAGAGGAAAAACAAGAGGCTTTTTAAAGAAGCTAAGAAGCCAGGGGAAGTTGTTATCAAAGGTCACAGGAGTTATGAT
TTGATGCTTAGTTTGCAGCTTGGAATCAGATACACAGTGGGGAAAATAACGCCTATACAAAGAAGAGAAGTAAGGACAGC
GGACTTTGGACCTAGGGCTAGCTTTTGGATGAGTTTTCCTCGAGCTGGCTCCGCGATGACGCCTCCTCATCACTCTGAAG
ATTTTAAATGGAAGGACTATTGTCCAATGGTATTCAGGAACCTGAGGGAGATGTTCAAGATGGATTCAGCTGATTACATG
ATGTCCATTTGTGGAAATGATACCTTAAGGGAACTTTCTTCACCAGGGAAGAGTGGGAGTGTCTTCTTCTTGTCTCAGGA
TGATCGGTTCATGATTAAAACACTCAGGAAATCTGAAGTCAAGGTTCTCCTGAGGATGCTTCCATATTACCATCATCATG
TGAAGACGTATGAGAACACCCTCATTACTAAATTCTTTGGCCTTCACAGAATAAAACCATCAAGTGGTCAAAAGTTCCGC
TTTGTGGTGATGGGTAACATGTTCTTTACAGATCTAAGAATCCATAGGAGATTTGACCTTAAAGGTTCGAAGTTGGGACG
CTCTGCAGACAAAGTGGAGATAGACGAGAACACTATACTTAAAGATTTAGATCTGAACTACAGCTTCTTCTTGGAGCCTT
CTTGGCGGGAGGGTTTACTAAAGCAACTAGAGATCGATAGCAAGTTCTTGGTAGAGCAGAACATAATGGATTACAGCCTT
TTGCTCGGTGTGCATCACCGAGCTCCAGAGCATTTAAGGACCCAGTTGGTCCGTTCTCGAAGTATAACAGCTGATGCGTT
AGAGAGTGTAGCTGAAGATGATACAATCGAGGACGACATGTTATCTTACCACCAGGGACTAGTTCTTGTTCCTGGAGGGA
GTGATAATGTTGTAACTGGTCCTCACATCAGAGGCAGCAGATTGCGAGCGTCCGCTGTGGGAGATGAAGAAGTCGATCTC
CTTCTCCCTGGAACAGCCAGGCTGCAGATACAGCAAGGAGTGAACATGCCGGCGAGAGCAGAGTTGATACCGGGAACAGA
AGAGAAAGACAGACAGATACTACACGATTGCTGCGACGTGGTGCTTTATCTAGGCATTATAGATATATTACAAGAGTACA
ACATGACCAAGAAGATAGAGCATGCTTACAAGTCTCTTCATTTTGATTCTAAATCGATCTCAGCCGTTGATCCTACTTAC
TACTCCCAGCGTTTTCTTGACTTCATAGAGAAGGTGTTTCCTCAGAACAACGCATAA