Details for Kale Locus Bo5g137860

Position : C5 ( 5`- 43041053 .. 43041734 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137860

Protein [Map View]
MAQMITTLVLLIEILFLLNYVSQIATTAAANDGDVIHVTGKVMCQDCTLNYDQWINGSEPIKGAVVSITCMDERERVRYY
GSDKTDERGQFDLIVDKVLYGGKNLKPHLCNVRLVSPADQSCGIPTDFGNGQTGEKLVQPFMVFKDLVKFVVGPFYYTTP
MCDTPKYENNY*

DNA
ATGGCGCAGATGATCACGACACTGGTTCTGCTCATAGAGATACTGTTTCTGTTAAATTATGTGAGTCAAATAGCCACGAC
CGCAGCAGCTAACGACGGAGATGTGATTCACGTCACCGGGAAAGTGATGTGCCAAGATTGCACTCTTAACTACGACCAAT
GGATCAACGGCTCTGAACCCATCAAAGGGGCTGTGGTATCAATCACATGTATGGACGAGAGGGAAAGAGTGAGATACTAT
GGCAGCGACAAAACCGATGAAAGAGGCCAGTTCGATCTTATCGTCGACAAAGTCCTCTACGGCGGAAAGAATCTCAAGCC
TCATCTTTGTAATGTCCGGCTCGTGTCTCCTGCTGACCAATCATGTGGTATTCCGACCGATTTTGGTAATGGTCAAACCG
GAGAGAAGCTAGTTCAGCCGTTCATGGTTTTCAAGGATCTGGTGAAGTTTGTAGTTGGGCCATTTTATTATACCACCCCC
ATGTGTGACACCCCTAAATATGAAAACAACTACTAG