Details for Kale Locus Bo5g137850

Position : C5 ( 5`- 43032271 .. 43034366 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137850

Protein [Map View]
MKRMRPNRLFVFGDSYADTGNIRKSLADSWKMPYGVSFPGKPSGRFSDGRIATDFLARYLGIKSPIPYTWKNYAGKERLL
FGMNYAYGGTGVFKTFNNPLPNMTTQIDYFQKVLASGNIYTPSDLHTSLALVSNAGNDYGTFILQKRLMTEFPGFIKQVV
DQTEVNLRRIHKLGVKKIAIASLQPLGCLPSKTTSSSFKHCNASDNALVKLHNILLRRAVAKLNNETKPSTFVILDLYKA
FLTVLKNKRAKTGVTRFVNPLKPCCVGITSNDSCSNVDKKGEKKYTICKDPKTSFFWDVFHPTEEGWRSVYSVLRENLKA
VLI*

DNA
ATGAAGCGTATGAGACCAAATAGGTTGTTCGTGTTCGGAGATTCATATGCAGATACGGGAAACATAAGAAAGTCCCTAGC
CGATTCCTGGAAAATGCCTTACGGCGTCAGTTTTCCTGGAAAACCCTCCGGTCGTTTCTCCGACGGCCGCATCGCCACCG
ATTTTCTCGCAAGATACTTGGGGATAAAGTCACCGATTCCGTACACGTGGAAGAATTACGCGGGAAAGGAACGGCTGTTG
TTCGGAATGAATTATGCGTATGGAGGGACGGGAGTGTTCAAGACATTCAATAATCCATTGCCAAACATGACAACTCAGAT
TGATTATTTCCAGAAAGTCCTCGCCTCGGGCAACATCTACACTCCCTCCGACCTCCACACTTCCCTTGCCCTCGTCAGCA
ACGCCGGCAACGACTACGGCACTTTCATTCTCCAAAAACGCCTCATGACCGAGTTCCCGGGATTCATCAAGCAGGTTGTT
GATCAAACTGAGGTAAACTTGAGACGCATCCACAAGCTGGGAGTGAAGAAGATAGCAATAGCTTCACTGCAGCCACTCGG
ATGTCTCCCTAGCAAAACCACCTCTAGTTCATTCAAACATTGCAACGCATCAGATAACGCATTAGTGAAACTTCACAATA
TTTTATTGCGTAGAGCCGTGGCGAAGCTCAACAATGAGACCAAACCTTCCACTTTCGTCATTCTTGATCTCTACAAGGCC
TTCTTGACTGTCCTCAAGAACAAAAGAGCGAAAACTGGGGTTACGAGGTTTGTGAACCCATTGAAACCGTGTTGTGTCGG
GATTACAAGCAATGACTCGTGCTCAAACGTGGACAAGAAGGGTGAGAAGAAGTATACAATTTGCAAAGATCCAAAGACTT
CCTTCTTTTGGGATGTCTTTCATCCGACAGAAGAAGGGTGGAGATCCGTTTACTCGGTTTTACGCGAAAACCTCAAAGCC
GTTTTGATTTAA