Details for Kale Locus Bo5g137840

Position : C5 ( 5`- 43031395 .. 43031670 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137840

Protein [Map View]
MGKVSLLLNFLISHAAKQESMENFDRNGASGSGFKMPLHYPKYTKDDYEKMEEWRLDLLLSDYGLIAFHDTSTLHEKRAI
AIETFLWPNAY*

DNA
ATGGGGAAAGTGAGCTTGCTTCTTAACTTTCTCATTAGCCATGCCGCCAAGCAAGAAAGCATGGAGAACTTTGACAGAAA
CGGAGCATCAGGCAGTGGGTTTAAGATGCCTTTGCATTACCCAAAATACACAAAGGATGATTACGAGAAGATGGAAGAGT
GGAGACTTGATTTGCTTCTCTCAGACTACGGACTCATTGCTTTCCACGACACTAGTACTCTCCATGAGAAGCGAGCTATT
GCGATCGAAACTTTTCTGTGGCCTAATGCGTACTAA