Details for Kale Locus Bo5g137800

Position : C5 ( 5`- 43003574 .. 43005939 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137800

Protein [Map View]
MASCDDDFSLLGEDQSNPNQHHHHHHNQVLHHAPYAPRRFAPKLSNQQIHVPHHQSNGDEDDEHHDVVASSAFHGVNPFS
ADENSNPYDNNNAAVEGGDEDLGANRSRIGGGVRLEKRQSQEELSDGGTTNGGGSFKRPRTSSSSAGEYRKDREEWSDAA
ITCLLDAYSDKFTQLNRGNLRGRDWEDVAATVSERCEKLIKSVEQCKNKIDNLKKRYKLERHRMSSGGTSASHWPWFKKM
EEIVGNSMTTKGASDEDRSGSSLGNAAKPARRYPLVTYNPGVQINNVKSKATSNPRWRRVVLKISGAALACTGPNNIDPK
IVGLIAREVAMACRLGVEVAIVVGSRNLFCGGTWITATGLDRTTAYHISMMASVMNSVLLQSSLEKMGVQARLQTGIAVQ
GVGEPYNRQRATRHLDKGRVVIFGGIGATLGNPLLSSDAAAALRAIDINAEAMVKGTNVEGVYDCHSQDSNATFEHITFH
DLASRGLTTMDTMALNFCEENSIPVVVFNFLEAGNITKALCGEQVGTLIDRTGRGVS*

DNA
ATGGCTTCCTGTGACGACGACTTCTCTCTTCTAGGAGAGGATCAATCAAACCCCAACCAACATCACCACCACCACCACAA
CCAGGTTCTCCACCACGCGCCGTACGCTCCCAGACGATTCGCCCCGAAGCTCTCGAACCAGCAGATCCACGTCCCTCATC
ACCAGAGCAACGGCGACGAGGACGACGAGCACCACGACGTCGTCGCGTCTTCCGCTTTTCACGGCGTGAATCCCTTCTCG
GCCGACGAGAACTCGAATCCCTATGATAACAACAACGCGGCTGTGGAAGGAGGAGACGAGGATCTGGGCGCGAACAGATC
CAGAATCGGCGGAGGAGTTCGTCTGGAGAAGAGGCAGAGTCAGGAGGAGCTCAGCGACGGAGGAACGACGAACGGCGGCG
GTAGCTTCAAACGGCCGAGGACGTCGTCTTCCTCCGCCGGCGAGTACAGGAAAGATAGAGAGGAGTGGAGCGACGCGGCG
ATCACGTGTCTGTTGGATGCGTACTCTGACAAGTTCACGCAGCTCAACAGAGGGAATCTCCGGGGGAGGGATTGGGAAGA
CGTTGCTGCGACGGTGAGCGAGAGGTGTGAGAAGCTGATCAAGAGTGTGGAGCAGTGTAAGAACAAGATTGATAATCTCA
AGAAGAGGTATAAGCTAGAGAGGCATAGGATGAGTAGCGGCGGAACGTCGGCTAGCCATTGGCCTTGGTTCAAGAAGATG
GAAGAGATTGTTGGCAACTCCATGACCACAAAAGGTGCGTCTGATGAGGATAGAAGCGGCAGCTCGCTGGGGAATGCTGC
CAAGCCAGCGAGGAGGTATCCTTTGGTGACGTATAACCCTGGGGTTCAGATTAATAACGTCAAGTCCAAGGCTACATCAA
ACCCTAGATGGCGAAGAGTGGTTTTGAAAATCAGTGGTGCAGCTCTTGCCTGCACAGGGCCTAATAACATTGATCCGAAG
ATCGTTGGTCTGATTGCTAGAGAAGTTGCAATGGCTTGTCGTCTTGGTGTAGAGGTAGCAATAGTTGTTGGGAGTCGGAA
CTTATTTTGCGGTGGTACATGGATTACTGCTACTGGTTTGGATAGAACCACTGCATATCATATCAGTATGATGGCGTCTG
TGATGAATTCTGTTTTGCTTCAGTCATCTCTGGAGAAAATGGGAGTTCAGGCACGGTTACAAACTGGAATTGCGGTTCAG
GGGGTCGGGGAGCCGTACAATCGTCAACGAGCCACTCGACATCTTGATAAAGGCAGAGTGGTAATATTTGGTGGCATTGG
TGCAACGCTTGGCAATCCACTTTTATCATCCGATGCAGCTGCAGCTCTTCGAGCTATAGATATTAATGCAGAGGCAATGG
TGAAAGGAACAAACGTGGAAGGTGTTTATGACTGCCATTCACAAGATAGTAACGCCACATTCGAGCACATAACATTTCAC
GATTTGGCTTCTAGAGGTCTTACAACAATGGACACAATGGCCCTTAACTTCTGTGAAGAGAATAGCATTCCAGTTGTGGT
GTTTAACTTTCTGGAAGCTGGGAACATCACAAAGGCATTGTGCGGAGAACAAGTGGGCACTTTAATCGACAGGACCGGGA
GGGGTGTGAGTTAG