Details for Kale Locus Bo5g137790

Position : C5 ( 5`- 42998563 .. 42999825 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137790

Protein [Map View]
MESNVMFSGFSPTTLSLETPQNPPNPVQFQHPHPHPYTAANDQQTHQQQQQPMKQLYPYAAKTKQLSPISVGGGGEEDDR
GSGSGSGCHPEDSAGTDGKRKISPWHRMKWTDTMVRLLIMAVFYIGDEAGGLGGDQTDGKKKISGGILQKKGKWKSVSRA
MVEKGFSVSPQQCEDKFNDLNKRYKRVNDILGRGTACRVVENQGLLEGMDHLTPKLRDEVKKLLNSKHLFFKEMCAYHNS
CGHLDQNQIPVQSKPDHKGCFQMAMIVEREEEEGESDMAEDSETEIEDTDEEEEEEEETSKKRRVSAAVKRMREETARVL
DDPGKSAWEKKEWMRRKALEIEERKVGYEWEAVEMEKQRVKWIRYRSKKEREMEKAKLENQRRSLETERMVLVLRRREIE
LTELQLAGKRVDPSSATGVR*

DNA
ATGGAATCTAATGTAATGTTCTCTGGGTTTAGTCCCACAACGTTAAGCCTCGAGACTCCTCAGAATCCTCCAAACCCAGT
TCAGTTTCAGCATCCTCATCCGCACCCTTACACAGCCGCCAACGATCAGCAAACTCATCAACAACAACAACAACCGATGA
AACAGTTATACCCTTACGCAGCCAAGACCAAACAGCTCTCGCCAATAAGCGTCGGCGGAGGAGGAGAAGAAGACGACCGC
GGGTCGGGTTCCGGATCCGGGTGCCACCCGGAAGACAGCGCCGGAACCGACGGGAAGAGGAAAATCTCTCCGTGGCACCG
GATGAAATGGACTGACACTATGGTCCGGCTCCTCATCATGGCGGTTTTCTACATCGGCGACGAGGCCGGTGGGTTGGGAG
GAGATCAAACCGACGGGAAGAAGAAGATCAGTGGGGGGATTCTGCAGAAGAAAGGGAAGTGGAAGTCCGTGTCGAGAGCC
ATGGTGGAGAAAGGCTTCTCAGTGTCGCCGCAGCAGTGCGAGGACAAGTTCAACGACTTGAATAAAAGGTACAAGAGAGT
CAACGACATTCTCGGGAGAGGCACGGCTTGTCGTGTAGTGGAGAATCAGGGTTTGTTAGAAGGGATGGATCATCTCACGC
CCAAGTTGAGAGACGAGGTTAAGAAGCTGCTTAACTCTAAGCATTTGTTTTTTAAGGAGATGTGCGCTTATCATAATAGC
TGCGGGCATTTAGACCAAAATCAGATCCCGGTTCAGTCTAAACCGGATCATAAGGGGTGTTTTCAGATGGCGATGATTGT
GGAGAGAGAGGAGGAGGAGGGAGAGTCTGATATGGCGGAGGATTCGGAGACGGAGATTGAGGACACGGATGAGGAGGAGG
AGGAGGAAGAGGAGACGAGTAAGAAGCGGAGGGTATCCGCGGCTGTGAAGCGGATGAGAGAGGAGACGGCGCGCGTGTTG
GATGATCCCGGGAAGAGCGCGTGGGAGAAGAAGGAGTGGATGAGGAGGAAGGCGCTGGAGATTGAGGAGAGGAAGGTCGG
GTACGAGTGGGAGGCGGTGGAGATGGAGAAGCAGAGGGTGAAGTGGATAAGGTATAGGAGCAAGAAAGAGAGGGAGATGG
AGAAGGCTAAGCTGGAGAACCAGCGGAGGAGTCTTGAGACGGAGAGGATGGTTCTGGTTCTGAGGCGGAGGGAGATTGAG
CTGACGGAGTTGCAGTTGGCGGGTAAACGGGTCGACCCGAGTTCAGCGACCGGGGTGAGATGA