Details for Kale Locus Bo5g137780

Position : C5 ( 5`- 42994756 .. 42997539 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137780

Protein [Map View]
MDSVRLPTAPSTLRSQMLGHTLPHRLPRIPLPPCNRHFESKPLIAITRSRNRVSPIAVISGNETSISPPDSPPPRLKVNP
SSLQYPAGYLGAVPDRASDPENGSITEAMEYLTSILSTKVYDVAIETPLHLAKKLSERLGVSMFLKREDLQPVFSFKIRG
AYNMMAKLPSEQLAKGVICSSAGNHAQGVAMSAAKLGCTAVIVMPRTTPEIKWQSVEDLGATVVLVGDTYDEAQAFAKQR
AEEEGLTFIPPFDHPDVIAGQGTVGMEITRQAKGPLHAIFVPIGGGGLIAGIAAYVKRVSPEVKIIGVEPADANSMALSL
HHGERVILNQIGGFADGVAVKEVGEETFRICRKLIDGVVLVTRDAMCASIKDMFEEKRNILEPAGALAIAGAEAYCKYYG
LKDVNVVAITSGANMNFDKLRIVTELANVGRQQEAVLATILPEKPGSFKQFCELVGPMNITEFKYRCGSRKDAVVLYSVG
VHTPGELKALEKRMESSQLKTTNLTTSDLVKDHLRYLMGGRSSVENEVLCRFIFPERPGALMKFLDSFSPRWNISLFHYR
AEGAAGANVLVGIQVPENEMEEFRNRAQVLGYEYVLVSEDINFKLLMQ*

DNA
ATGGATTCCGTCAGGCTTCCAACGGCTCCTTCCACCCTCCGTTCCCAAATGCTAGGTCACACCTTACCCCATCGCCTCCC
TCGCATTCCGCTACCTCCTTGCAATCGCCACTTCGAATCGAAACCTCTTATCGCGATCACTCGATCTCGGAACCGCGTCT
CTCCGATCGCCGTCATCTCCGGAAACGAAACGTCCATATCTCCGCCGGATTCTCCTCCGCCGCGTCTCAAGGTCAATCCG
AGCTCTCTGCAGTACCCCGCCGGCTACCTCGGCGCGGTTCCGGACCGCGCGAGCGATCCGGAGAACGGAAGCATCACCGA
GGCGATGGAGTATCTGACGAGCATACTCTCCACGAAGGTCTACGACGTCGCGATCGAGACTCCGCTCCACTTGGCCAAGA
AGCTATCGGAGAGGCTTGGCGTTTCGATGTTTCTCAAGAGAGAAGACTTGCAACCTGTGTTCTCGTTTAAGATTCGCGGA
GCTTACAATATGATGGCGAAGCTTCCATCAGAGCAGTTAGCGAAAGGCGTCATCTGCTCCTCAGCTGGAAACCATGCTCA
AGGAGTTGCTATGTCTGCTGCTAAGCTCGGCTGCACCGCCGTGATTGTTATGCCTCGTACAACCCCAGAGATCAAGTGGC
AATCTGTGGAGGACTTGGGTGCGACGGTTGTTCTTGTTGGGGATACTTATGATGAAGCACAAGCATTTGCTAAGCAACGA
GCTGAAGAAGAAGGTTTGACGTTCATACCTCCTTTCGATCACCCGGATGTTATCGCCGGACAAGGGACTGTCGGGATGGA
GATCACAAGGCAAGCTAAAGGTCCTTTACACGCTATATTTGTGCCCATCGGTGGTGGTGGTTTGATAGCTGGTATTGCTG
CTTATGTGAAGAGAGTTTCTCCCGAGGTGAAGATCATTGGTGTAGAACCAGCTGATGCAAATTCAATGGCGTTGTCTCTG
CATCACGGCGAGAGAGTGATATTAAATCAGATTGGTGGTTTTGCAGATGGTGTAGCGGTTAAAGAAGTTGGTGAAGAGAC
TTTCCGTATATGCAGAAAGCTGATCGACGGTGTTGTTCTTGTCACTCGTGATGCTATGTGCGCATCAATAAAGGATATGT
TTGAGGAGAAACGGAACATATTAGAACCAGCAGGTGCTCTTGCGATCGCTGGAGCTGAAGCGTACTGTAAATATTATGGC
CTAAAGGACGTGAACGTTGTAGCCATAACCAGTGGTGCAAACATGAACTTTGACAAGCTCAGGATTGTGACAGAACTCGC
CAATGTCGGTAGGCAACAGGAGGCTGTTCTTGCTACTATCTTGCCGGAAAAGCCTGGAAGCTTTAAGCAATTTTGTGAAT
TGGTTGGACCAATGAACATAACCGAGTTCAAGTATAGATGTGGCTCGAGAAAGGATGCTGTTGTTCTATACAGTGTTGGA
GTGCACACACCCGGAGAGCTCAAAGCACTAGAGAAGAGAATGGAATCTTCTCAACTCAAAACTACGAACCTTACAACCAG
TGACTTAGTAAAAGATCACCTGCGTTACTTGATGGGTGGAAGATCAAGTGTTGAAAACGAGGTTCTATGCCGATTCATAT
TCCCGGAGAGACCAGGTGCTCTAATGAAGTTCTTGGACTCTTTCAGTCCACGGTGGAACATTAGCCTTTTCCATTACCGT
GCAGAGGGTGCGGCGGGGGCCAACGTGCTGGTCGGGATCCAAGTCCCAGAGAATGAAATGGAGGAATTTCGAAACCGAGC
TCAAGTTCTTGGATACGAGTACGTCTTGGTAAGTGAGGACATCAATTTCAAGCTTTTGATGCAGTGA