Details for Kale Locus Bo5g137750

Position : C5 ( 5`- 42983147 .. 42983644 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137750

Protein [Map View]
MGNCIVMEKKVIKIMRNDGEVVEYRGPMKVHDILTQFSGHYSLFDSLSNHCHLHPQAKLLCGRLYYLMPKQTTTVKHKKT
KKVRFANPEVEKEGDTKEKSPSVVRVKMVVSKKELEKLLQGGSIHEVVYRSLDKQHLCRDDDDAAAADECLTGWRPLLDS
IPESD*

DNA
ATGGGGAATTGTATAGTAATGGAGAAGAAAGTGATAAAGATAATGAGAAATGATGGAGAAGTAGTTGAATACAGAGGACC
CATGAAGGTTCATGACATCCTCACCCAATTCTCTGGTCACTACTCTCTCTTTGATTCTCTGTCAAACCATTGTCATCTTC
ATCCACAAGCCAAGCTTCTCTGTGGTCGTCTCTACTATCTCATGCCGAAGCAGACGACCACAGTAAAGCACAAGAAAACG
AAGAAAGTCAGGTTTGCAAATCCAGAGGTTGAAAAAGAAGGAGATACCAAGGAGAAGAGTCCTAGTGTCGTGAGAGTGAA
GATGGTTGTGAGTAAGAAAGAGCTAGAGAAGCTGCTTCAAGGAGGTTCAATTCATGAAGTGGTGTATAGGAGTCTTGATA
AGCAGCATCTATGTCGTGATGATGATGATGCTGCTGCTGCTGATGAATGTCTTACAGGCTGGAGACCTTTGTTAGATAGC
ATTCCAGAATCTGATTAG