Details for Kale Locus Bo5g137740

Position : C5 ( 5`- 42980014 .. 42981853 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137740

Protein [Map View]
MISSNIAPPPLSLLSSSPNNFSFDLRSYPNINRGDALFFAPASEPRLSGRVGICPQPKLGFLSFSLSPLRPPPSLNATAK
YAFPKRFNSSNLEEAFMSVPDLETMNFRVLSRTDRYEIREVEPYYVAETTMPGGNGFDFYGASRSFNVLAEYLFGKNTVN
EKMEMTTPVVTRKVQSVGEKMEMTTPVITRKAKDQTQWQMSFVMPSKYGSDLPLPKDPSVKIQEVPRKIVAVLAFSGYVT
DEEIERREQELRRALQNDKKFRVRDGVSVEVAQYNPPFTLPFTRRNEVSLEVESKDY*

DNA
ATGATCAGCTCCAATATTGCACCACCACCCCTTTCTCTACTCTCTTCGTCTCCTAACAACTTCTCCTTCGATCTCCGATC
GTATCCTAACATAAACAGAGGAGATGCTCTGTTCTTTGCTCCGGCGTCAGAACCGCGGCTAAGCGGCAGAGTCGGGATTT
GTCCGCAACCGAAGCTAGGGTTTCTCTCGTTCTCGCTCTCGCCTCTCAGGCCTCCTCCGTCTCTCAACGCCACTGCGAAG
TATGCGTTTCCGAAGAGATTCAATAGCTCGAACCTGGAAGAAGCCTTCATGTCTGTTCCGGATCTCGAGACGATGAACTT
CAGAGTTCTAAGCAGGACTGATAGATACGAGATCAGAGAAGTCGAGCCTTATTATGTGGCGGAGACTACAATGCCAGGTG
GAAATGGATTCGACTTCTATGGTGCTTCCAGGTCTTTCAATGTCTTAGCTGAGTACCTCTTTGGTAAGAACACGGTGAAT
GAAAAAATGGAGATGACGACTCCTGTTGTTACTCGTAAAGTCCAATCCGTTGGTGAAAAGATGGAGATGACCACTCCAGT
TATAACTAGGAAGGCGAAAGATCAAACCCAGTGGCAAATGTCTTTCGTCATGCCATCAAAGTACGGTTCAGATTTGCCAC
TGCCAAAAGATCCTTCGGTCAAGATTCAGGAGGTGCCACGGAAGATTGTTGCTGTTCTCGCCTTCTCAGGATATGTAACC
GATGAAGAGATTGAGAGACGGGAGCAAGAACTAAGGCGAGCTCTTCAGAATGACAAGAAGTTCCGAGTGAGAGATGGAGT
TTCAGTTGAAGTTGCACAGTACAATCCACCATTCACTCTCCCGTTTACCCGCCGCAACGAGGTCTCTCTCGAAGTGGAAA
GCAAAGATTATTAG