Details for Kale Locus Bo5g137730

Position : C5 ( 5`- 42976474 .. 42978294 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137730

Protein [Map View]
MKERSKDTQTLFCSIVLNNMKRSSSFLIFTVLSLPLISAVGWELSIPSTTTARSRLRVREGSRFKIAIFADLHFGEDSWT
DWGPRQDENSVNVMSKVLDAETPDFVVYLGDVVTANNIAIHNASLFWDKAISPTRDRNIPWTSLFGNHDDASFVWPLDWF
SSSGIPPIICPSVSNSSSWSSDDGCGFRGTTRVELIQEELKAANALSYSTIGPKELWPSVSNYVIPVESSDDSIQVVALL
YFLDSGGGSYPEVISNAQVEWFKTKSNTLNPDLSIPELIFWHIPSKAYKKVAPRLWITRPCVGSINKERVDAQEAENGMM
RVLEKRSSVKAVFVGHNHGLDWCCPYKDKLWLCFARHTGYGGYGNWPRGSRILEITEVPFRIKSWIRMEDGAVHSEVNLT
SD*

DNA
ATGAAAGAAAGATCAAAAGACACACAAACTTTGTTCTGTTCGATCGTCTTGAATAATATGAAAAGATCGTCGTCATTTCT
GATCTTCACCGTTCTATCCCTTCCACTAATCTCAGCCGTAGGTTGGGAGCTAAGCATACCGTCAACGACCACGGCAAGAA
GTCGTCTTCGAGTCCGAGAAGGATCACGGTTCAAGATCGCAATCTTTGCAGACCTCCACTTCGGCGAAGACTCGTGGACT
GATTGGGGTCCACGTCAAGATGAAAACTCTGTCAACGTCATGTCTAAAGTTCTTGACGCTGAAACTCCAGATTTTGTGGT
GTACTTGGGAGATGTAGTAACGGCTAACAACATAGCAATCCATAACGCAAGCTTGTTTTGGGACAAAGCAATCTCACCTA
CACGAGATAGAAACATCCCATGGACTAGTCTCTTTGGTAACCATGACGACGCCTCTTTCGTTTGGCCTTTGGACTGGTTC
TCTTCCTCTGGTATCCCTCCCATTATCTGTCCCTCAGTATCAAACTCCTCCTCCTGGTCCTCTGATGATGGATGCGGTTT
TAGAGGAACAACGAGAGTGGAACTGATTCAAGAAGAGCTTAAAGCAGCCAATGCACTCTCATACTCAACCATTGGTCCTA
AGGAGCTATGGCCAAGCGTGTCAAACTACGTCATTCCCGTGGAGTCATCTGATGATTCGATACAAGTCGTTGCGTTGCTG
TACTTTCTTGACTCGGGAGGTGGTTCATACCCGGAGGTTATATCAAATGCTCAAGTGGAGTGGTTTAAAACCAAGTCCAA
TACTCTTAATCCTGATCTAAGTATCCCGGAGTTGATATTTTGGCACATACCAAGTAAAGCATACAAGAAAGTAGCTCCAC
GGCTATGGATAACGAGACCTTGCGTCGGATCAATCAACAAAGAGAGAGTAGATGCTCAAGAAGCTGAAAATGGTATGATG
AGAGTTCTTGAGAAGAGATCTTCTGTTAAGGCTGTGTTTGTAGGACACAACCATGGACTAGACTGGTGCTGTCCGTACAA
AGACAAGCTGTGGCTTTGCTTTGCAAGGCACACTGGTTATGGTGGATATGGAAATTGGCCAAGAGGATCAAGGATTCTTG
AGATTACTGAAGTGCCTTTTCGGATTAAGTCTTGGATTCGGATGGAAGATGGAGCTGTCCATAGTGAAGTTAACTTAACT
AGTGATTAG