Details for Kale Locus Bo5g137710

Position : C5 ( 5`- 42969355 .. 42970011 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137710

Protein [Map View]
MKFAKLNPKRLFRSKDRATVSKSTASSGSASSFSSGAADECNNHSSAVTGGSVTPTSILPEVSAVHSPYSYVEILQAFKL
IDRDNDGAVSRHDLESFLTRLGPDPPTEEEIDVMLKEVDCDGDGTIRLEELASRCVVVSSEDDNKSRGCSDELKETFEFF
DADRDGKISAEELLRVFSAIGDERCTLEECERMIAAVDDDGNGFVCFAEFSRMMDLQR*

DNA
ATGAAATTCGCAAAACTGAATCCAAAACGTTTGTTCAGATCCAAAGACCGTGCAACGGTCTCTAAATCCACCGCTTCCTC
CGGATCCGCTTCGTCTTTCTCCTCCGGCGCCGCGGACGAGTGTAATAATCACTCCTCCGCCGTCACCGGAGGCTCCGTCA
CTCCCACCAGCATACTCCCGGAGGTCTCAGCCGTTCATTCTCCCTACTCGTACGTCGAGATCCTCCAGGCGTTCAAGCTG
ATCGACAGAGACAACGACGGAGCCGTCTCGAGGCACGACCTGGAGTCGTTCCTCACGCGCCTCGGTCCCGATCCTCCGAC
GGAGGAGGAGATCGACGTCATGCTCAAGGAGGTGGACTGCGACGGAGACGGTACGATTCGCCTGGAAGAGCTCGCCAGCC
GCTGCGTCGTCGTCTCCTCGGAGGATGATAATAAGTCTCGCGGCTGCTCGGACGAGCTGAAGGAGACGTTCGAGTTCTTC
GACGCGGATCGCGACGGTAAGATCTCGGCCGAGGAGCTTCTCCGAGTTTTCTCGGCCATTGGTGACGAGCGGTGCACGTT
AGAGGAGTGCGAGCGCATGATAGCGGCCGTTGACGATGACGGTAACGGATTCGTGTGCTTCGCTGAGTTCTCGAGAATGA
TGGATCTCCAGCGATGA