Details for Kale Locus Bo5g137680

Position : C5 ( 5`- 42959734 .. 42961482 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137680

Protein [Map View]
MATSRLQMEGDDSVLLHVTHSNLKSFAADVRFSPQMNVEAVKEKLWKKCGTSVNAMALELYDESGSKVAVLSDDTRPLGF
YSPFDGFRLHIVDLDPSSVTTGGWLEDTSLVEKYTISEEDYAKRTDSYRKFKEKIVAQKPAASDVKTKEDFMEDLCANIK
VGDRCQVVPGEKRGVVKYVGRAESLGPGYWVGIQYDEPLGKHDGMVKGTRLFECPQLHGGVVRPDKVKVGDYPERDPFED
DEI*

DNA
ATGGCGACTTCGCGGTTACAGATGGAAGGAGATGACTCTGTACTTCTCCACGTAACTCACTCCAACCTCAAGAGCTTCGC
TGCCGATGTTCGTTTCTCTCCGCAAATGAATGTGGAAGCTGTGAAGGAAAAGCTATGGAAGAAATGCGGGACATCTGTTA
ACGCTATGGCTTTAGAGCTTTATGATGAGAGTGGCTCCAAGGTTGCAGTCCTCAGTGATGATACGAGACCACTCGGTTTC
TACTCCCCTTTTGATGGGTTTCGGTTACACATAGTAGATCTTGACCCTTCCTCGGTCACAACTGGAGGGTGGCTTGAAGA
TACTTCATTGGTTGAGAAGTATACTATCTCAGAAGAGGACTATGCTAAACGAACTGACAGTTATAGGAAATTCAAAGAAA
AAATAGTGGCTCAGAAGCCTGCTGCTTCTGACGTTAAGACGAAGGAGGACTTCATGGAAGATCTCTGTGCAAATATCAAG
GTGGGAGATAGATGCCAAGTTGTGCCCGGGGAGAAAAGAGGAGTGGTTAAGTACGTTGGACGAGCAGAGTCGTTGGGTCC
TGGCTATTGGGTTGGGATCCAGTACGATGAACCCCTTGGCAAACACGATGGCATGGTGAAAGGAACAAGATTATTTGAAT
GCCCTCAGCTTCATGGTGGTGTGGTCCGGCCAGACAAAGTAAAGGTTGGTGATTATCCAGAAAGAGACCCATTCGAGGAT
GATGAAATATAA