Details for Kale Locus Bo5g137670

Position : C5 ( 5`- 42958002 .. 42959501 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137670

Protein [Map View]
MDTLLRTPNKLEFFIPQFHGFERLSPNPSRVKLGVKKRTIRIGSTSTSSSSSALLDLVPETKKENLDFDLPLYDTSLNKV
VDLAIVGGGPAGLAVAQQVSEAGLSVCSIDPSPKLIWPNNYGVWVDEFEAMDLVDCLDTTWSGAVVYINDGSEKDLSRPY
GRVNRKQLKSKMLQKCITNGVRFHQAKVTDVVHEEVNSTVVCSDGVKIQASVVLDATGFSRCLVQYDKPYNPGYQVAYGI
VAEVDGHPFDVDKMVFMDWRDKHLDAYPEVKERNSKIPTFLYAMPFSSNRIFLEETSLVARPGLKMEDIQERMVARLKHL
GINVKRIEEDERCVIPMGGPLPILPQRVVGIGGTAGMVHPSTGYMVARTLAAAPIVANAIVRYLGGGNNNGLRGDELSAE
VWRDLWPIERRRQREFFCFGMDILLKLDLDATRRFFDAFFDLEPRYWHGFLSSRLFLPDLVFFGLSLFSHASNTSRLEIM
TKGTVPLAKMINNLVKDRD*

DNA
ATGGATACTCTCTTGAGAACACCCAACAAGCTCGAGTTTTTCATCCCTCAGTTTCATGGGTTTGAGAGATTAAGTCCAAA
TCCTTCACGGGTCAAGCTTGGTGTGAAGAAAAGAACAATCAGAATCGGTAGTACTAGTACTAGTAGTAGTAGCAGTGCTC
TTTTGGATCTTGTTCCTGAAACCAAGAAGGAGAATCTTGACTTCGACCTTCCCTTATACGACACTTCCCTGAACAAAGTT
GTTGATCTAGCTATCGTTGGCGGCGGCCCCGCTGGTTTAGCCGTGGCTCAGCAAGTCTCCGAAGCTGGACTCTCTGTCTG
CTCCATCGATCCTTCCCCCAAACTCATTTGGCCTAACAACTACGGAGTTTGGGTTGACGAGTTCGAAGCCATGGACTTGG
TAGACTGCCTCGACACCACCTGGTCCGGCGCCGTCGTCTACATCAACGACGGCTCCGAAAAGGACCTGTCCCGGCCTTAC
GGGAGAGTCAACCGTAAACAGCTCAAATCCAAGATGCTTCAGAAGTGCATCACCAACGGTGTTAGATTCCATCAGGCTAA
AGTCACTGACGTGGTTCACGAGGAGGTTAACTCCACTGTGGTTTGCAGTGACGGTGTGAAGATTCAGGCTTCTGTTGTTC
TCGACGCTACTGGGTTTTCAAGATGCTTGGTGCAGTATGATAAACCGTACAACCCGGGTTATCAAGTAGCTTATGGTATC
GTTGCTGAGGTCGATGGTCACCCGTTTGATGTGGACAAGATGGTGTTTATGGACTGGAGAGATAAGCATCTTGACGCGTA
CCCTGAGGTTAAAGAACGGAACAGCAAGATCCCTACGTTCTTGTACGCGATGCCGTTTTCTTCAAACAGAATCTTTCTCG
AGGAGACGTCTCTTGTGGCTAGGCCGGGTCTGAAGATGGAAGATATCCAAGAGAGGATGGTTGCGAGGCTGAAACATTTG
GGGATCAACGTGAAGCGGATTGAGGAAGACGAGCGTTGTGTGATCCCTATGGGAGGTCCTTTACCGATCTTGCCTCAAAG
AGTTGTTGGCATTGGCGGTACAGCGGGGATGGTTCATCCTTCGACTGGTTACATGGTTGCTAGGACTCTTGCAGCTGCTC
CGATAGTTGCAAACGCTATAGTGAGGTACCTTGGTGGTGGTAACAACAACGGCTTGAGAGGAGATGAGCTCTCGGCTGAG
GTGTGGAGAGACTTGTGGCCTATTGAGAGGCGGAGACAGAGGGAGTTCTTCTGTTTTGGGATGGATATTTTGCTGAAGCT
TGATTTGGATGCTACTAGGAGGTTCTTTGATGCGTTCTTTGACCTGGAACCGCGTTACTGGCATGGTTTCTTGTCGTCGA
GGCTGTTTCTCCCGGACCTGGTGTTCTTCGGGCTGTCGCTCTTCTCGCATGCTTCTAATACCTCGAGGTTGGAGATCATG
ACTAAGGGAACTGTTCCTCTTGCTAAGATGATCAACAATTTGGTTAAAGATAGAGACTAA