Details for Kale Locus Bo5g137660

Position : C5 ( 5`- 42954739 .. 42956719 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137660

Protein [Map View]
MSSGTVRRVSRQDIQLVQNLIERCLQLYMNQKEVVETLLEQAKIEPGFTELVWQKLEEENREFFNAYYLRLMVKHQIMEF
NKLLEQQVRHMQQMHPTGLTSIQNTNGSHIQSMNQKQLGYASEHTDHQSLKPNAHHPMPSSLSNAYLNGSSTLNTNVSPS
VNMSTHARRVDTCPNMLSSQTTTNMPPMMQGMNGGGGGGMIKSETAFTNPPSFMYGGERNNALEGHSTGRETPIPSFSNE
SNNNQPIGDTLLDAEASTFGFLGSIPRNFSLSDLTADFSQSSEILESYDKSPFLAPDAENFLDSCDRGEYQGDNKRLDTI
SEGFSYDNLGSE*

DNA
ATGTCAAGTGGAACAGTGAGAAGGGTCTCGCGTCAAGACATACAACTGGTTCAAAACCTTATAGAACGATGCCTTCAACT
TTACATGAATCAGAAAGAAGTTGTGGAAACTTTACTGGAACAGGCTAAAATCGAGCCTGGGTTCACAGAGTTAGTTTGGC
AGAAGCTTGAAGAAGAGAACCGCGAATTTTTCAACGCGTACTATCTGAGGCTCATGGTGAAACACCAGATCATGGAATTC
AACAAGCTACTTGAGCAGCAGGTTCGCCATATGCAGCAGATGCATCCAACTGGACTTACCTCCATCCAGAACACAAATGG
TTCTCACATCCAATCAATGAACCAGAAACAGTTGGGATATGCCTCTGAACACACTGATCATCAATCATTGAAGCCTAATG
CACATCATCCCATGCCATCGAGTCTGTCTAACGCATACCTCAACGGCTCTTCAACGCTCAACACAAACGTGTCCCCTTCT
GTGAACATGTCGACCCACGCTAGGAGAGTTGACACTTGTCCGAATATGCTCTCATCACAGACTACCACAAACATGCCCCC
TATGATGCAAGGGATGAATGGAGGAGGAGGAGGAGGGATGATCAAGTCCGAGACTGCCTTTACAAACCCTCCTTCGTTCA
TGTATGGTGGCGAACGGAACAACGCCTTGGAAGGACATTCCACAGGTAGAGAAACTCCGATCCCATCTTTCAGTAACGAG
TCCAACAACAACCAGCCCATTGGTGATACGCTTCTTGATGCAGAAGCTTCTACTTTTGGGTTCTTAGGATCAATTCCTAG
GAACTTCAGCCTCTCTGACTTGACTGCTGATTTTTCACAGAGCTCAGAGATTCTGGAGAGCTATGATAAATCACCATTCC
TTGCGCCAGATGCTGAAAATTTCCTGGACTCCTGCGACAGGGGAGAATATCAAGGAGACAACAAGAGATTGGATACCATA
TCTGAAGGTTTCAGTTACGACAACCTCGGGAGCGAGTAG