Details for Kale Locus Bo5g137640

Position : C5 ( 5`- 42944870 .. 42950679 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137640

Protein [Map View]
MALLQRPAPYLHFYFRLMASRSRLFSHSLCPSLHRHSSSLSSSTPRIKFQLAKVLSQRLVIRNAVSPRSFMSSTMDTDAL
HESSTSKDYSSEHIQVLEGLDPVRKRPGMYIGSTGSRGLHHLVYEILDNAIDEAQAGFASKIDVVLHADGSVSISDDGRG
IPTDLHPATRKSSLETVLTVLHAGGKFGGKSSGYSVSGGLHGVGLSVVNALSEALEVIVRRDGMEFQHKYSRGKPITTLT
CHVLPPESRGTQGTCIRFWPDKEVFTTAIQFDHNTIAGRIRELAFLNPKVTISLKKEDDDPERDLYSEYFYAGGLTEYVS
WLNTDKKPLHDVLGFRKEINGTTVDVALQWCSDAYSDTMLGYANSIRTIDGGTHIEGVKASLTRTLNSLAKKLKVIKEKD
ISLSGEHVREGLTCIVSVKVPDPEFEGQTKTRLGNPEVRKIVDQSLQEYLTEYLELHPDVLESIISKSLNAYKAALAAKR
ARELVRSKSILKSSSLPGKLADCSSTDPAESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIERKDEAAMYKNEEI
QNLILGLGLGVKGEDFNMENLRYHKIIILTDADVDGAHIRTLLLTFFFRYQRALFDAGCIYVGVPPLFKVERGKQAHYCY
DEAALKQVIASFPGNASYNIQRFKGLGEMMPEQLWETTMNPDTRILKQLVVDDAAETNVVFSSLMGARVDVRKELIKSAA
TRMNLENLDI*

DNA
ATGGCTCTTCTTCAGAGACCAGCCCCTTATCTTCACTTCTATTTTCGCCTCATGGCTTCTCGTTCTCGTCTCTTCTCCCA
CTCTCTATGCCCTTCACTTCACCGTCACTCCTCGTCTCTTTCCTCTTCAACACCCAGGATAAAGTTCCAGTTAGCAAAGG
TTTTGAGTCAGAGACTTGTAATTAGAAATGCGGTCTCACCAAGGTCCTTTATGTCATCGACCATGGACACTGATGCTCTC
CATGAGAGCTCCACCTCTAAGGATTACAGTTCCGAGCACATTCAAGTGTTGGAAGGCTTAGACCCTGTCAGGAAAAGACC
TGGGATGTATATTGGTAGCACTGGATCTCGTGGTTTGCATCATCTGGTTTATGAGATACTTGACAACGCAATTGACGAGG
CACAAGCTGGTTTTGCTTCAAAGATTGACGTTGTTTTACATGCAGATGGTTCAGTCAGCATTTCTGATGATGGACGTGGG
ATACCTACGGACTTGCATCCCGCAACGAGAAAATCTTCACTGGAGACTGTCCTCACGGTCTTACACGCAGGGGGTAAGTT
TGGTGGCAAGAGTAGCGGATACAGCGTGTCTGGTGGATTGCATGGTGTAGGTTTATCCGTTGTGAATGCTTTGTCAGAGG
CATTGGAGGTTATTGTTCGCAGAGATGGGATGGAGTTTCAGCATAAGTATTCTCGTGGAAAGCCCATAACAACACTTACA
TGTCATGTCCTCCCACCAGAGTCAAGGGGCACTCAAGGGACATGCATCAGGTTTTGGCCTGACAAAGAAGTATTCACAAC
CGCAATTCAATTTGACCATAACACTATTGCTGGAAGAATTAGGGAGCTTGCTTTTCTTAATCCGAAGGTTACAATCTCTC
TGAAAAAGGAGGATGATGATCCAGAAAGAGACCTGTATAGTGAATATTTTTATGCTGGAGGTTTAACTGAGTATGTTAGC
TGGCTAAATACCGATAAGAAACCGCTCCATGATGTGCTGGGTTTCCGGAAAGAGATAAATGGCACCACCGTTGACGTTGC
ACTTCAATGGTGCTCAGATGCCTATTCAGACACGATGCTGGGATATGCGAATAGTATTCGCACTATTGATGGTGGGACAC
ATATTGAAGGTGTGAAGGCTTCGTTAACAAGAACTCTAAATAGCCTCGCAAAAAAGTTAAAGGTTATCAAGGAGAAGGAT
ATTAGCTTAAGTGGGGAACATGTTAGAGAGGGATTGACCTGCATTGTCTCAGTCAAGGTTCCTGATCCTGAGTTTGAAGG
TCAAACAAAGACGAGACTGGGGAATCCAGAGGTGAGGAAAATTGTTGACCAATCACTCCAGGAGTACCTCACGGAGTACT
TGGAATTGCATCCTGATGTTCTTGAAAGCATTATTTCCAAATCCTTGAATGCGTACAAGGCTGCTCTGGCTGCCAAGAGG
GCTAGGGAGTTGGTCAGATCAAAAAGCATTTTGAAGTCATCCTCACTTCCTGGGAAACTGGCAGATTGCTCATCTACAGA
TCCTGCAGAATCTGAAATTTTTATAGTGGAAGGAGATTCGGCGGGTGGCAGCGCAAAACAGGGCCGTGACAGGCGTTTCC
AGGCGATTCTTCCTTTAAGAGGTAAAATTTTGAATATTGAGAGAAAGGATGAAGCAGCCATGTACAAGAACGAAGAAATT
CAAAATCTAATTCTTGGTCTTGGTCTTGGAGTGAAGGGAGAAGATTTCAACATGGAGAATTTGCGTTACCATAAGATTAT
CATATTAACAGATGCAGATGTTGACGGTGCTCATATCCGAACACTCCTGTTGACCTTTTTCTTCAGATATCAGAGAGCCT
TGTTTGACGCTGGTTGCATATACGTTGGTGTTCCACCTCTTTTCAAGGTTGAGAGGGGGAAACAGGCGCACTATTGCTAT
GACGAGGCAGCTCTTAAACAAGTTATCGCTTCGTTCCCTGGAAATGCATCCTACAACATTCAGAGGTTCAAAGGTTTGGG
TGAGATGATGCCTGAGCAGCTATGGGAAACAACAATGAATCCAGATACAAGGATACTGAAGCAACTAGTTGTTGATGACG
CAGCAGAAACAAATGTGGTCTTTTCATCTCTCATGGGTGCTAGGGTCGATGTCCGGAAAGAACTCATCAAAAGCGCTGCG
ACTAGAATGAACCTGGAGAATCTTGACATATAA