Details for Kale Locus Bo5g137630

Position : C5 ( 5`- 42941574 .. 42944115 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137630

Protein [Map View]
MLPLLHLRFFFCHPHARGKELVSLISHQNTHFDLISSTKKMNNKKNPDQKPEMSSSSSSSSSPKKQTLFISSLIILWYTS
NIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYLSIVFLKLVPLQHLKSRSQFMKVATLSIVFCASVVGGNVSLRYL
PVSFNQAVGATTPFFTALFAYLMTFKREAWYGALVPVVTGVVIASGGEPGFHWFGFIMCISATAARAFKSVLQGILLSSE
GEKLNSMNLMLYMSPIAVIALLPVTIVMEQDVMSVTLSLARQHKYMWVLLLVNSVMAYSANLLNFLVTKHTSALTLQVLG
NAKGAVAVVISILLFRNPVTVMGIGGYSITVLGVVAYGETKRRFR*

DNA
ATGCTTCCTTTATTACATCTACGCTTCTTCTTTTGTCATCCCCATGCTCGAGGCAAGGAGCTAGTTTCTCTCATCTCCCA
TCAAAACACACATTTCGATCTCATCTCTTCAACAAAGAAGATGAACAACAAGAAGAACCCAGATCAGAAACCAGAAATGT
CCTCATCGTCTTCATCTTCATCTTCTCCCAAGAAACAAACCCTCTTCATATCATCCCTAATCATCCTCTGGTACACCTCC
AACATCGGCGTCCTCCTCCTCAACAAGTTCCTCCTCTCAAACTACGGATTCAAATTCCCCATCTTCCTCACGATGTGCCA
CATGTCAGCCTGCGCCATCCTCAGCTACCTCTCCATCGTCTTCCTCAAGCTCGTCCCTCTCCAGCACCTCAAATCTCGCT
CTCAGTTCATGAAAGTCGCGACTCTCAGCATTGTCTTCTGTGCCTCCGTCGTTGGAGGGAACGTCTCCCTTCGTTATCTT
CCCGTCTCGTTTAATCAGGCTGTAGGTGCCACGACGCCGTTTTTCACAGCGCTCTTTGCGTATCTCATGACGTTTAAGAG
AGAGGCTTGGTACGGTGCTCTTGTCCCTGTTGTTACCGGTGTCGTGATCGCCAGTGGGGGTGAGCCAGGTTTTCACTGGT
TTGGATTCATTATGTGCATCAGTGCTACTGCAGCAAGAGCTTTTAAATCAGTTCTTCAAGGCATCTTACTTTCTTCTGAA
GGAGAAAAGTTGAACTCGATGAATTTGATGCTGTACATGTCCCCCATAGCAGTCATTGCACTTCTGCCCGTAACAATAGT
AATGGAACAAGATGTGATGAGTGTGACACTATCCCTCGCAAGACAACATAAGTACATGTGGGTACTTCTCTTGGTTAACT
CTGTAATGGCTTATTCAGCCAACTTGTTGAACTTTCTTGTTACCAAGCACACAAGCGCACTTACCCTCCAGGTTCTTGGA
AACGCCAAAGGAGCGGTTGCTGTTGTGATCTCGATCTTGCTTTTCAGAAACCCGGTCACGGTGATGGGAATTGGCGGGTA
TAGTATAACGGTGCTTGGGGTTGTTGCTTATGGAGAGACTAAACGCAGGTTTAGATGA