Details for Kale Locus Bo5g137530

Position : C5 ( 5`- 42901034 .. 42902620 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137530

Protein [Map View]
MLTDSYMDTRSNMTNVDLQVELESLLHQHRNRQSFPQPDVVVDVHRSGSAPPTVEGLLRAMDNKLIITTTLITLETLRTS
TTLTTAASSFYPTTSYVGTLCTSRTTTPTTTRTPGCLIRCYLERIGDSLRGFTAVTGEWRKNVVEADNNSSSSSLFKVQP
GVEQAENDLIELRNAVAQGRHVLQRLDPSGLGPRRKSFADILHDNRDAALYSQLSRPASCNTFHESLHSATMLGSTMSSP
VPRNRTPDSHLVGRSPSSGLSPIGTRVCGPVEKNNLFGVESYTDVADTLSRLNMSEMSQVKDNHMRVELENHSDVMRYIP
NGHKKALRQQSIAMTEPSDQLLSANYGGVMSGYGASLGASSTVGSHGEHVNIPKRTSSSASHYSTSDRSRLGSLGLSDVN
IQNANINGTDFSTAGGYVVNNKLNSLADLYAEDSHLTGEGDRQILNRLMNQAASELHS*

DNA
ATGCTTACTGATAGTTACATGGATACGAGATCAAACATGACCAATGTGGATCTCCAGGTGGAGCTCGAATCTCTGCTCCA
TCAACACCGTAACCGCCAATCATTTCCCCAACCAGACGTTGTCGTCGACGTGCACAGAAGCGGAAGCGCGCCGCCGACGG
TGGAAGGTTTGTTAAGAGCCATGGATAATAAATTAATAATCACTACAACTCTGATTACATTAGAGACGCTGCGAACGTCA
ACAACACTAACAACGGCCGCGTCGAGCTTTTATCCGACGACGAGTTACGTTGGCACCCTGTGTACCTCTCGTACTACTAC
TCCAACGACCACTCGAACCCCAGGCTGCCTCATCCGTTGCTATCTAGAGAGGATTGGAGACTCGCTCAGAGGTTTCACAG
CAGTGACTGGGGAGTGGAGGAAGAATGTGGTTGAAGCCGACAACAATAGCAGCTCTTCATCGCTCTTCAAGGTTCAGCCA
GGTGTTGAGCAGGCAGAGAATGATTTGATTGAGCTGAGGAACGCTGTAGCACAGGGACGCCATGTGCTACAGCGTCTTGA
TCCTTCAGGGCTTGGACCGAGAAGGAAGAGCTTCGCTGATATACTTCATGACAACCGAGACGCAGCGTTATACAGCCAAC
TCTCTCGGCCTGCGAGTTGCAACACTTTCCACGAATCATTACACTCTGCTACTATGCTTGGGTCCACCATGAGTTCTCCT
GTGCCAAGGAATAGAACTCCCGACTCACATCTAGTGGGACGGTCCCCGTCCTCTGGTCTGTCTCCTATTGGTACCAGAGT
TTGTGGTCCTGTGGAGAAGAATAATTTGTTTGGCGTAGAATCTTACACTGATGTTGCGGATACATTGTCGAGGTTGAACA
TGTCAGAGATGAGTCAAGTAAAAGATAACCATATGCGGGTGGAATTGGAGAATCATTCTGATGTCATGCGTTACATACCC
AATGGTCATAAGAAGGCTTTGCGTCAGCAGAGTATTGCTATGACTGAGCCAAGCGATCAGTTGCTTTCTGCAAATTATGG
TGGAGTTATGAGTGGTTATGGAGCAAGCCTTGGTGCTTCTTCTACGGTCGGTTCTCACGGAGAACATGTCAACATCCCTA
AACGAACCTCCTCTTCAGCGAGTCATTACTCAACTTCAGACCGCTCTAGATTGGGAAGCCTGGGGTTATCTGATGTCAAT
ATTCAGAATGCAAATATCAATGGAACGGACTTCTCCACAGCTGGTGGTTATGTGGTAAATAACAAGTTGAATTCATTAGC
TGACCTCTACGCTGAAGACTCACATTTGACTGGGGAAGGGGATAGACAAATCTTGAATAGATTGATGAATCAAGCTGCTT
CTGAGCTTCACTCTTAA