Details for Kale Locus Bo5g137520

Position : C5 ( 5`- 42891890 .. 42894725 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137520

Protein [Map View]
MSPASSLRRLAVGAAVIAAASGGGAVYLSPSVASSDRGGGPVLDSLRRRIGDPNASVPSRSAQESVLIGASASNPLDVLV
IGGGATGSGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIHGGVRYLEKAVFNLDYGQLKLVFHALEERKQLIENAPHL
CHALPCMTPCFDWFEVVYFWMGLKMYDLVAGPRLLHLSRYYSAQESAELFPTLARKGKDRSLRGTVVYYDGQMNDSRLNV
GLACTAALAGAAVLNHAEVVSLITDEATKRIVGARVRNNLTGKEFESYAKVVVNAAGPFCDSIRKMVDEDTKPMICPSSG
VHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSNTSITPLPEPHEDEIQFILDAISDYLNIKVRRTDVLS
AWSGIRPLAMDPTAKSTESISRDHVVFEENPGLVTITGGKWTTYRSMAEDAVDATIKSGKLSPTNECVTQKLQILGSHGW
EPSSFTALAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVAIIAQEEGLGKRLAHGHPFLEAEVAYCARHEYC
ESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDKSREKQELQKAKEFLETFKSSKNAQFHDGKHN*

DNA
ATGTCACCAGCCTCCTCCCTCCGCCGCTTAGCCGTCGGAGCCGCCGTAATCGCCGCCGCATCCGGCGGTGGCGCTGTCTA
CCTCTCCCCGTCGGTCGCCTCCAGCGACAGAGGCGGTGGTCCGGTTCTGGATTCGCTGAGGCGCAGGATCGGCGATCCAA
ACGCTTCCGTGCCTTCTCGATCCGCTCAAGAGTCTGTTCTGATCGGAGCCAGCGCCTCTAATCCTCTCGATGTCCTCGTC
ATTGGCGGTGGAGCCACTGGCTCTGGAGTCGCGCTCGACGCTGCGACGCGTGGCCTCCGTGTTGGCCTGGTGGAGCGTGA
GGATTTCTCCTCGGGGACGTCTTCTCGTTCGACGAAGCTTATCCATGGAGGTGTTCGGTACTTGGAGAAAGCTGTGTTCA
ATCTTGACTACGGACAGCTGAAGCTTGTATTCCACGCGCTCGAGGAGCGCAAACAGCTCATCGAGAACGCGCCGCATCTC
TGCCACGCTCTCCCCTGTATGACACCTTGTTTCGACTGGTTCGAAGTTGTCTACTTCTGGATGGGACTGAAGATGTACGA
CTTGGTCGCAGGACCGCGGTTACTGCATCTCTCTAGATACTACTCTGCGCAAGAGTCTGCTGAGCTCTTCCCAACTCTTG
CAAGGAAAGGGAAAGACAGGAGCTTGAGAGGCACTGTTGTGTATTACGACGGGCAAATGAATGATTCACGTCTGAATGTG
GGGTTGGCTTGTACTGCTGCGTTGGCTGGTGCTGCTGTTCTCAACCATGCTGAGGTTGTGTCGCTTATTACAGATGAGGC
TACTAAGAGAATAGTTGGTGCCAGAGTTCGTAACAATCTCACAGGCAAAGAATTTGAGAGCTATGCGAAAGTGGTTGTTA
ATGCGGCTGGACCGTTCTGTGACTCCATTAGGAAGATGGTTGATGAAGATACAAAACCGATGATATGTCCAAGCAGCGGT
GTACACATCGTGCTCCCTGATTACTATTCTCCAGAAGGGATGGGGTTGATAGTCCCTAAAACTAAGGATGGTCGCGTTGT
GTTCATGTTACCGTGGTTGGGAAGAACAGTAGCAGGTACTACAGACTCTAACACATCGATCACTCCGCTTCCAGAACCTC
ATGAGGATGAGATTCAGTTTATTCTGGATGCAATCAGTGACTATCTTAACATTAAGGTTCGACGTACTGATGTTCTCTCG
GCTTGGAGTGGTATCCGACCATTGGCAATGGATCCAACAGCAAAGAGCACAGAGAGTATCTCCAGAGACCATGTTGTCTT
CGAGGAAAACCCTGGTCTGGTCACAATCACTGGTGGAAAATGGACTACTTATCGAAGTATGGCGGAAGATGCGGTGGATG
CAACAATCAAATCGGGAAAGCTGAGTCCAACCAATGAATGTGTAACGCAGAAGCTACAGATTCTTGGTTCTCATGGATGG
GAACCATCTTCTTTCACAGCTCTTGCGCAGCAATACGTGCGCATGAAGAAAACATATGGTGGTAAAGTGGTTCCTGGAGC
AATGGACACAGCTGCGGCTAAGCATTTGTCTCATGCCTATGGTTCAATGGCTGACCGAGTCGCCATAATAGCTCAGGAGG
AAGGTTTGGGGAAACGGTTGGCACATGGACATCCGTTTCTGGAAGCAGAGGTTGCTTACTGTGCAAGGCACGAGTACTGC
GAGTCAGCGGTTGATTTCATAGCAAGGAGATGTAGAATAGCGTTCTTGGACACAGACGCAGCAGCGAGGGCGTTGCAGCG
TGTGGTGGAGATTCTAGCGAGTGAACACAAGTGGGACAAGTCGAGGGAGAAGCAGGAGTTGCAAAAGGCTAAAGAGTTTC
TTGAAACTTTCAAGTCTTCCAAAAACGCACAGTTTCACGACGGCAAACACAACTAA