Details for Kale Locus Bo5g137510

Position : C5 ( 5`- 42882972 .. 42891022 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137510

Protein [Map View]
MGTFDGLPVPSDKTYLREELARIDESWVAARFDSLPHVVHILTSKDRETDILLLREQSDVVEEVVDEVVHAYHGGFNKAI
QNYSQILRLFSESTDKIGDLKHDLAEAKRSLGTRNKQLHQLWYRSVTLRHIIALLDQIEGIAKVPSRIEKLIADRQFYAA
IQVYLQSSLMLEREGLQTVGALQDVRSELAKLRGALFFKILDDLHAHLYNRGEYSSVASSIYERDDEVPTTTAVAASRMS
SQPLSRRTRTLKGDSQFGVRGLTNGSYRTASTEEGSSFDGHDEEDSVEHDEATGDGQTIRNGTDSKLLSYQLPPWLSDSS
PDEFIEAVRKSDDPLHVKYLQTLVQCLCMLGKVAAAGAIICQRLRPTIHEIIISKIKAHMETKNLSKSACSQGDRTGAAG
LHFIKGQSEAYRLSKDKPQNGTSNSGTHLAVSPVSPLMAPGGKAQAAAKDLLDSILDTIVKIFENHVVVGELLELRASQH
DINTPKSLPTDVNWNADSEASQATGGYTISFPLTVLQSECQQLICEILRATPEAASADAAAQTAKLAKKAPKKDKRDASE
DGVTFTFRFTDATVSISNQGADLIRQGWGKRAPNSSQEGYGSAAVLPEQGMYLAASIYRPVLQFTDKITSMLPKKHSQLV
NDGLLTFTENFVKDHLLPTMFVDYRKGVQQAISSAAAFRPRAHTTTYTPTVEKGRPILQGLLAIELLAKEVLGWAQAMPK
FATDLVKYVQTFLERTFERCRTAYMEAVLEKLSYRLIGRHDIERLMRLDTGSACLPSQLGHSVSHSEAVGSEVELCELFL
NLPSIKQDNLIRDDNKLILLASLSDSLEYVADSIERLGQAVPRAASQAEGNSRNQATSPRNLASFADEYRKLATDCLKVL
RVEMQLETVFHLQEMTNREYLEDEDAEEPDDFVISLTSQITRRDEGMAPFISGEKRNYVFGGICGIAASASIKALADMRS
INLFGVQQICRNTIALEQAMAAIPYVDGDSVQQNLDRVRTYYELLNMPFEALLAFIAEHDQMFTPTEYSNLLKVNVPGRD
TPSDAQIRLSEILSH*

DNA
ATGGGGACTTTCGATGGTTTGCCTGTTCCCTCCGATAAAACTTACCTTAGGGAGGAGCTGGCACGAATAGATGAGAGCTG
GGTTGCTGCACGCTTTGACTCTTTGCCACATGTGGTCCATATCCTTACCTCAAAAGACCGTGAAACCGACATTCTTTTAT
TAAGGGAGCAAAGTGATGTTGTCGAGGAGGTTGTTGATGAAGTTGTCCATGCTTATCATGGTGGTTTCAACAAAGCCATT
CAAAACTACTCTCAGATCTTGCGACTATTCAGCGAGTCCACTGATAAAATAGGCGACTTGAAGCATGATTTGGCAGAAGC
AAAGAGGAGCTTGGGGACACGCAATAAACAATTACACCAGTTGTGGTACCGTTCTGTAACATTGCGGCACATCATTGCGC
TTTTGGATCAAATCGAGGGCATTGCTAAGGTTCCATCTCGTATTGAGAAGCTCATTGCTGATAGGCAGTTTTACGCTGCT
ATTCAAGTGTATCTCCAGTCTTCGCTGATGCTTGAGCGTGAGGGGCTTCAAACGGTTGGTGCTCTTCAAGATGTCAGATC
TGAGCTAGCTAAGCTGCGGGGTGCCCTTTTCTTCAAAATTCTAGACGATTTGCATGCACATCTGTACAATAGAGGTGAAT
ACAGTTCAGTTGCGTCAAGCATATATGAAAGAGATGATGAAGTACCAACAACAACAGCTGTTGCAGCAAGTCGAATGAGC
TCACAACCACTCTCTCGTAGAACACGGACACTGAAAGGTGATAGTCAGTTTGGTGTTAGAGGCCTCACAAATGGTTCATA
TAGAACGGCTTCTACTGAGGAAGGTTCATCATTTGATGGACATGATGAGGAGGACTCTGTAGAACATGATGAAGCCACCG
GAGATGGACAGACTATCAGGAATGGCACTGATAGTAAATTGCTTTCTTACCAACTTCCACCTTGGCTTTCTGATTCCTCT
CCTGACGAGTTTATCGAAGCAGTAAGAAAAAGTGATGATCCACTGCATGTGAAGTATCTACAGACTCTTGTTCAGTGTCT
TTGCATGCTCGGCAAAGTTGCAGCTGCTGGTGCTATTATATGCCAAAGACTTCGACCCACGATACATGAGATCATAATAT
CCAAGATTAAAGCCCATATGGAGACTAAAAATTTGTCAAAGTCAGCCTGTAGTCAGGGTGATCGAACGGGAGCTGCGGGA
TTGCATTTTATCAAAGGACAGTCCGAGGCCTACAGATTATCAAAAGATAAACCGCAAAATGGGACATCAAATTCTGGAAC
TCACCTGGCTGTGAGCCCTGTCTCGCCTCTTATGGCTCCTGGAGGCAAAGCGCAGGCTGCAGCAAAAGATCTTCTTGACT
CAATTTTAGATACTATTGTCAAGATATTTGAAAATCATGTTGTTGTTGGAGAGCTTTTGGAGTTGAGGGCTTCGCAACAT
GACATTAACACACCGAAGTCATTGCCTACTGATGTGAATTGGAACGCCGATTCTGAAGCATCCCAAGCTACTGGAGGTTA
CACTATCAGTTTTCCTTTGACAGTCTTACAGAGTGAATGCCAACAACTGATATGTGAAATTCTAAGAGCAACTCCAGAAG
CTGCGTCAGCAGATGCTGCGGCACAAACTGCTAAACTTGCAAAGAAGGCTCCCAAGAAAGATAAAAGGGATGCATCTGAA
GATGGGGTAACTTTCACCTTTCGGTTCACAGATGCAACTGTATCGATTTCTAATCAGGGAGCGGATCTCATTCGTCAAGG
CTGGGGAAAGAGGGCTCCAAATTCATCACAGGAAGGTTATGGATCTGCAGCAGTTTTGCCTGAACAGGGAATGTATCTAG
CTGCATCTATTTACCGGCCTGTCCTTCAGTTTACAGATAAAATCACTTCGATGTTGCCCAAAAAGCATTCTCAGCTTGTG
AATGATGGATTGCTTACATTCACCGAGAACTTTGTGAAGGACCACCTGTTACCGACAATGTTTGTGGACTATAGGAAAGG
CGTACAGCAAGCTATATCAAGTGCTGCCGCATTTAGGCCCCGTGCACATACAACTACTTACACCCCAACCGTAGAAAAGG
GTCGACCTATCTTGCAAGGTCTTTTGGCTATAGAACTCCTTGCAAAAGAGGTTCTTGGTTGGGCTCAAGCCATGCCTAAA
TTTGCTACTGACCTTGTGAAGTATGTTCAGACATTTCTTGAGAGAACATTTGAGAGATGTCGAACAGCATACATGGAGGC
TGTGCTGGAGAAGCTCAGTTACAGGCTCATTGGGAGGCATGATATTGAGAGATTGATGCGACTTGACACGGGAAGTGCAT
GTTTGCCATCTCAGCTTGGCCATTCTGTTTCGCACTCTGAGGCTGTTGGCTCCGAAGTAGAACTCTGTGAACTATTCTTA
AATTTGCCGTCTATTAAGCAGGATAATCTAATTCGTGATGACAACAAACTGATTTTGTTAGCGTCGCTTAGTGACTCGCT
TGAATACGTGGCAGACTCTATTGAGAGGCTTGGACAAGCAGTTCCTCGTGCAGCAAGTCAAGCTGAAGGTAATAGCAGGA
ATCAAGCAACTTCTCCAAGGAATCTGGCATCATTTGCTGATGAGTACAGAAAACTTGCCACTGATTGCCTTAAGGTTCTT
CGTGTTGAGATGCAATTGGAAACAGTCTTTCATCTTCAGGAAATGACAAATCGGGAATACCTGGAGGATGAGGATGCCGA
AGAGCCAGACGACTTTGTGATTTCTCTTACTTCACAGATAACACGTAGGGACGAGGGAATGGCGCCTTTCATCTCTGGTG
AGAAGCGCAATTATGTTTTTGGTGGCATTTGTGGAATTGCTGCAAGTGCGTCCATTAAGGCTCTGGCTGACATGAGATCA
ATCAACCTTTTCGGAGTTCAACAAATTTGTAGAAACACTATTGCATTGGAACAGGCCATGGCAGCTATTCCATATGTCGA
TGGTGACAGTGTACAGCAGAACCTAGATCGTGTCCGTACTTATTATGAACTACTGAACATGCCATTCGAGGCGCTACTTG
CATTCATAGCGGAACATGACCAAATGTTTACACCCACAGAGTATTCCAATCTCTTAAAGGTCAATGTTCCTGGAAGAGAT
ACTCCTTCAGATGCTCAAATCCGCCTTTCAGAAATTCTTTCTCACTAG