Details for Kale Locus Bo5g137500

Position : C5 ( 5`- 42880980 .. 42881777 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137500

Protein [Map View]
MVQTKKKKKVHHSDDEEEDDTFYYRYSSVAAPPSHPTKPSSSSSKSSAPPSGSGGLAPSKSTLYVSNLDFSLTNSDIHTL
FSTFGKVARVTVLKDRQTRRSRGVAFVLYVSRDDAGKAAKSMEGKILNGRKLTVSIAADNGRASEFIKKRVYKDKSRCYE
CGDEGHLSYECPRNQLGPRERPPPPKKRGRRREEEGAGEESRDWSGTDVTEEGVGEDNWASVVDNEAGERLRMREAEEEE
ERRRKRKEAAGKKVSYFSDESDDED*

DNA
ATGGTTCAGACGAAGAAGAAGAAGAAGGTCCACCACAGCGACGATGAAGAAGAAGACGACACTTTCTACTACCGCTACTC
CTCCGTCGCAGCACCCCCTTCTCACCCCACAAAACCTTCCTCCTCCTCCTCCAAATCATCAGCTCCTCCGAGCGGATCAG
GCGGCTTAGCCCCTTCCAAATCAACTCTCTACGTCTCGAATCTAGACTTCTCCCTCACAAACTCCGACATCCACACGCTC
TTCTCCACCTTCGGAAAGGTCGCGCGAGTCACCGTCCTCAAGGATCGCCAGACCCGCCGATCACGCGGCGTCGCCTTCGT
GCTCTACGTCTCGCGCGACGACGCGGGTAAAGCGGCGAAATCCATGGAAGGGAAGATCCTCAACGGAAGGAAGCTGACGG
TTTCGATCGCGGCGGATAACGGGAGGGCGTCGGAGTTTATAAAGAAGAGAGTGTACAAGGATAAGTCGAGGTGTTACGAG
TGTGGAGACGAAGGGCATCTTTCGTACGAGTGTCCTAGGAATCAGTTGGGTCCGAGAGAGAGACCGCCGCCGCCGAAGAA
AAGGGGGCGGAGGAGGGAGGAGGAAGGAGCGGGTGAGGAGTCGAGGGATTGGTCGGGGACGGATGTGACGGAGGAGGGGG
TTGGTGAGGATAATTGGGCTTCTGTGGTGGATAATGAAGCTGGGGAGAGGCTGAGAATGAGGGAAGCGGAGGAAGAGGAA
GAGAGGAGGAGGAAGAGGAAGGAAGCTGCAGGGAAGAAAGTTAGTTACTTTAGTGATGAGAGTGATGATGAAGATTGA