Details for Kale Locus Bo5g137490

Position : C5 ( 5`- 42877553 .. 42880309 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137490

Protein [Map View]
EIPKLAPTFPGTLQFFILSSHLYSTFLLTHIENLENTRKHSPEKKTKMEKLTFLSLLLHFAVFIACSSQSSSILLNDRSF
EIPNLPSSRAEKLIRELNLFPNLEVNVIDVGGSTLASEELPPIVERRFIFPNILPDGGAPSLEDLGHHAGYYKLPKSQGA
RMFYLFFESRSKKDAPLVIWLTGGPGCSSELAMFYENGPFKLDKNMSLAWNEYGWDQASNLLYVDQPVGTGFSYTSDKTD
IRHDQTGVSDDLYDFLQAFFAEHPKLANKDFYITGESYAGHYIPAFASRVHRGNKANEGIHVNLKGFAIGNGLTDPAYQY
PAYPDYAFEMGLITKAEHDRLTKIVPLCELSIKICGTDGTTSCLASYLVCNTLFSGVINHAHGVNYYDVRKKCEGSLCYD
FSDMEKFLNLNSVRKSLGVGEIEFVSCSTSVYQAMLQDLMRNLEVGIPALLEDGINLLVYAGEYDLICNWLGNSRWVHAM
EWSGKENFKAAKEVPFVVDGKEAGKVKSYEQLSFLKVHDAGHMVPMDQPKSALKMLEGWMKKSLGGGDAMATTTTEGDDM
VSQM*

DNA
GAAATTCCCAAATTAGCCCCAACTTTCCCGGGCACGCTTCAATTTTTCATACTTTCTTCCCACCTGTACAGCACCTTTCT
CCTCACTCATATAGAGAATCTCGAAAACACGAGAAAGCACAGTCCAGAAAAAAAAACGAAAATGGAGAAACTGACTTTCC
TCTCGCTGCTCTTGCACTTCGCCGTCTTCATCGCTTGTTCATCTCAGTCATCTTCAATCCTATTGAACGATCGCAGCTTC
GAGATACCGAACTTACCTTCATCGCGAGCCGAGAAGCTGATCCGGGAGCTGAACCTCTTTCCGAATCTGGAAGTGAACGT
GATCGATGTCGGTGGTTCGACTCTCGCTTCCGAGGAGTTACCTCCGATTGTCGAACGGAGATTCATATTCCCGAATATCC
TTCCCGATGGCGGCGCCCCTTCCCTCGAGGATCTAGGTCATCATGCTGGTTACTACAAGCTCCCCAAATCTCAAGGCGCA
AGGATGTTTTACCTCTTCTTCGAGTCGCGTAGCAAGAAGGATGCTCCTCTTGTGATTTGGTTGACGGGAGGGCCTGGATG
CAGCAGTGAATTGGCTATGTTCTATGAGAACGGTCCTTTCAAGCTCGATAAGAACATGTCTCTTGCTTGGAATGAGTATG
GTTGGGACCAGGCTTCCAATCTCCTGTATGTAGACCAGCCTGTTGGAACTGGTTTCAGCTACACCAGTGACAAAACTGAT
ATCCGTCATGACCAAACCGGAGTTAGCGATGATCTCTATGATTTTCTGCAGGCTTTCTTTGCGGAGCACCCTAAGCTGGC
GAATAAGGACTTTTACATAACTGGAGAGTCATATGCCGGACATTACATTCCGGCTTTTGCTTCCAGAGTCCATAGAGGAA
ACAAGGCTAATGAGGGGATTCATGTTAACCTTAAGGGATTCGCTATTGGAAATGGGCTTACAGATCCTGCGTACCAATAC
CCAGCCTATCCTGACTATGCGTTTGAAATGGGTTTAATTACTAAAGCAGAGCATGATCGTTTAACTAAGATTGTCCCATT
GTGTGAACTATCAATTAAGATTTGTGGAACTGATGGAACAACTTCCTGTTTGGCGTCATATCTTGTTTGCAACACCTTGT
TCAGCGGTGTAATAAATCATGCTCATGGAGTTAACTATTACGACGTCAGGAAGAAGTGCGAGGGAAGTTTGTGCTACGAC
TTCTCAGACATGGAGAAATTCTTGAATCTGAACTCGGTGAGAAAGTCGCTTGGTGTTGGGGAGATAGAGTTTGTGTCTTG
TAGTACTAGTGTCTACCAGGCAATGCTACAAGACTTGATGAGGAATCTCGAGGTCGGAATTCCCGCGCTCTTGGAAGATG
GAATCAACCTTCTTGTGTACGCGGGAGAATATGATCTCATCTGCAACTGGCTCGGTAACTCGAGGTGGGTGCATGCAATG
GAGTGGTCAGGGAAGGAGAACTTTAAGGCGGCTAAGGAAGTTCCCTTTGTGGTTGATGGTAAAGAAGCAGGCAAGGTTAA
GAGTTATGAACAACTCAGTTTCCTCAAGGTGCACGATGCTGGACATATGGTTCCAATGGACCAGCCAAAATCTGCGTTGA
AAATGTTGGAGGGATGGATGAAGAAGTCGCTTGGTGGAGGAGATGCTATGGCTACTACAACTACAGAAGGAGATGATATG
GTTTCTCAGATGTAA