Details for Kale Locus Bo5g137410

Position : C5 ( 5`- 42817855 .. 42818969 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137410

Protein [Map View]
MVGPCAKAPSAHVQSRRGSSVCMFFFLERYIGVGEEEQVQLFYYFIKYEGNPEEDPILLWLSGGPGCSSISGLLYENDFE
YNSLDQPVETGFSYSTTHKLASKPSDSGEAKCIHEFLHKVEINDDTPESKPSLEELDALEVKLASLSSLGFIHFHVTKGS
IGFQHLSNNGIHCHPRRLTGGASSKRVRHNSPTQLELVESYQLAVENLGTHLNPRLQILPRQFRSRALCCRENKGRLQRP
KTLFIYFILCCL*

DNA
ATGGTGGGACCCTGTGCCAAAGCACCGTCCGCACACGTCCAGAGCAGGCGAGGGAGTTCAGTTTGTATGTTTTTTTTTCT
TGAAAGGTATATTGGTGTTGGTGAGGAAGAACAAGTGCAGTTGTTCTACTATTTCATCAAATATGAGGGGAATCCTGAAG
AAGACCCTATTCTTCTCTGGTTAAGTGGAGGACCTGGTTGCTCTTCAATCTCTGGTCTTCTTTACGAGAATGATTTCGAG
TATAATAGTTTGGACCAACCTGTTGAAACTGGCTTCTCCTACTCAACAACTCATAAACTCGCTAGTAAACCTAGTGATTC
TGGAGAAGCCAAGTGTATCCACGAGTTTCTTCACAAGGTGGAGATCAACGATGATACTCCAGAGAGCAAACCAAGTTTAG
AAGAACTTGATGCCCTCGAGGTAAAACTAGCATCTCTTAGTTCACTAGGATTTATACATTTTCATGTTACAAAAGGCTCA
ATAGGGTTCCAACACTTGTCTAACAATGGAATACATTGTCATCCCAGGAGGTTGACCGGTGGAGCTTCTTCCAAGAGGGT
CAGACATAATAGTCCGACGCAGCTAGAGCTGGTGGAGAGTTATCAACTCGCAGTGGAGAATCTGGGAACTCATCTTAACC
CTCGTCTTCAGATACTTCCTCGTCAGTTTCGTAGCCGCGCCCTCTGTTGCCGGGAAAATAAAGGACGACTACAAAGACCA
AAGACTCTTTTTATCTATTTTATTTTGTGTTGTCTCTGA