Details for Kale Locus Bo5g137370

Position : C5 ( 5`- 42791724 .. 42792878 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137370

Protein [Map View]
METAEEAISAAKEQALILKGKRTKRQRLQSPIPFSIVPPMSSQEPDVEDESTSLVSKEKSLNDEINTNKNDNNMLSNGVT
SPASSSSNNNATLKTAADEEDQDMANCLILLAQGHYTPQQQPQQTRQFMMSYQESGNNNNNAYRSSSRRFLETSNGTTSG
GRAGYYVYQCKTCDRTFPSFQALGGHRASHKKPKAAAGLHSDHDLKKSIYNDAVSLHLNNVPAATPNNNSSHRSLVVYGK
ANNNKVHECGICGAEFTSGQALGGHMRRHRGAVVASAASASTATVRVAATAGTANTALSLSPMSFDQMSVHPVQAPVKRA
RSAVVSLDLDLNLPASEDVNRVNGLSFASKQEQEQEHEHEQTHQREEQKTLVLSSAPTLVDCHY*

DNA
ATGGAGACAGCAGAGGAGGCGATATCGGCAGCTAAAGAGCAAGCCTTGATCCTTAAAGGGAAGAGGACTAAGAGGCAGCG
TCTGCAGTCCCCAATCCCTTTCTCTATCGTCCCTCCTATGTCTTCTCAAGAACCTGATGTGGAAGATGAGTCCACCAGTC
TTGTTTCCAAGGAGAAGAGTCTCAATGATGAGATCAACACCAACAAGAATGATAACAACATGTTAAGCAATGGTGTGACA
TCTCCTGCCTCTTCATCTTCTAACAACAATGCAACATTAAAGACCGCCGCTGACGAGGAAGACCAAGACATGGCTAATTG
TTTGATCCTCCTCGCCCAAGGTCACTATACCCCTCAACAACAACCACAACAAACAAGACAGTTTATGATGAGTTACCAAG
AATCTGGTAATAACAATAACAATGCGTATAGATCTAGCAGCAGAAGGTTTCTCGAGACATCTAATGGGACCACGAGTGGA
GGCAGAGCCGGTTACTATGTTTACCAATGCAAAACGTGTGACCGGACTTTTCCTTCTTTCCAAGCTCTTGGTGGCCATAG
AGCCAGCCACAAGAAGCCTAAAGCCGCAGCGGGTCTTCACTCCGACCATGACCTCAAGAAGTCTATCTACAACGACGCCG
TTTCTCTTCATCTCAACAACGTCCCCGCCGCAACTCCTAACAATAATAGTAGCCACAGGTCGCTTGTGGTGTACGGCAAA
GCGAATAACAATAAAGTCCATGAATGTGGGATATGTGGAGCTGAGTTCACATCCGGACAAGCCTTAGGTGGTCACATGAG
ACGTCATAGAGGCGCAGTGGTGGCCTCAGCAGCATCCGCTTCCACCGCAACGGTTAGGGTTGCGGCCACTGCGGGTACAG
CAAACACGGCTTTGTCATTATCACCTATGTCGTTTGACCAAATGTCGGTTCATCCGGTTCAGGCTCCGGTTAAGAGAGCG
AGGAGCGCGGTTGTGTCGTTAGATTTGGATCTGAATCTACCTGCCTCGGAAGATGTGAATCGAGTCAACGGATTAAGCTT
TGCTTCAAAGCAAGAACAGGAACAGGAACATGAACATGAACAAACACATCAGAGAGAAGAACAAAAAACTCTTGTTTTGT
CTTCCGCTCCTACATTGGTGGATTGCCATTACTAA