Details for Kale Locus Bo5g137360

Position : C5 ( 5`- 42786148 .. 42788741 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137360

Protein [Map View]
MGRESVAVVSSPPTATARGTATVAATSLAPGFRFHPTDEELVSYYLKRKVMGKPVRFDAIGDVDIYKHEPWDLAVFSRLK
TRDQEWYFYSALDKKYGNGARMNRATNKGYWKATGKDREIRRDIQLLGMKKTLVFHSGRAPDGLRTNWVMHEYRLVDYET
ESNGNLVQDAYVLCRVFHKNNIGPPSGNRYAPFLEEEWADEGVALIPGVDVRVRAEPLPFANGNNQMDQPASKDLININE
PPRETTPMDIEVSHQNHHENAPKPQENNNNNHYDEAEEALKLEQAEEDERPPPACVLNKEAPLPLLQYKRRRQNEPNNNS
SRTTQDHCSSTITTVDNTPITLISSSAAAATNTAISALLEFSLMGISAKKENTPQPPNKEAYPPAPLPSIEEKLNDLQKE
VHQMSVERETFKLEMMSAEAMISILQSRIDALRQENDELRKNNATKGQAVL*

DNA
ATGGGTCGCGAATCTGTGGCTGTGGTGTCTTCGCCGCCGACGGCGACTGCGAGGGGTACTGCTACTGTAGCGGCGACATC
GCTTGCTCCTGGGTTTCGATTTCATCCGACTGATGAAGAACTCGTGAGCTATTACTTGAAGAGAAAGGTTATGGGTAAGC
CCGTACGTTTCGATGCGATTGGGGATGTCGATATCTACAAGCATGAGCCTTGGGACTTAGCAGTGTTCTCGAGGTTGAAG
ACAAGAGACCAGGAATGGTACTTCTACAGCGCGCTAGACAAGAAGTACGGGAACGGCGCTAGAATGAACCGAGCCACTAA
CAAAGGCTACTGGAAAGCAACTGGAAAAGACCGAGAAATCCGCCGTGACATTCAGTTGCTCGGTATGAAAAAAACACTCG
TTTTCCACAGCGGGCGTGCCCCGGATGGGCTCCGGACCAATTGGGTCATGCACGAGTATCGCCTTGTGGACTATGAAACT
GAATCCAATGGAAACCTCGTGCAAGATGCATATGTGTTGTGCAGAGTGTTCCACAAGAATAACATTGGGCCACCAAGTGG
GAACAGATACGCGCCATTCTTGGAAGAGGAATGGGCTGATGAGGGAGTCGCTCTGATTCCAGGAGTAGACGTTAGGGTCA
GGGCAGAGCCGCTACCTTTTGCCAATGGAAACAACCAGATGGACCAGCCAGCAAGCAAGGACCTCATTAACATCAACGAG
CCACCAAGAGAGACTACCCCAATGGATATCGAAGTTAGCCATCAGAATCATCATGAGAATGCCCCCAAGCCGCAGGAGAA
TAACAACAATAACCATTATGATGAAGCTGAGGAAGCACTCAAACTTGAGCAAGCAGAAGAAGACGAGCGTCCTCCTCCTG
CATGTGTTCTCAACAAAGAAGCTCCATTGCCTCTCCTTCAATACAAACGAAGACGCCAAAACGAACCAAACAACAACTCA
AGCAGGACCACACAGGATCACTGTTCGTCCACAATAACAACCGTCGACAATACACCAATAACTTTAATCTCATCATCTGC
TGCTGCTGCCACCAACACCGCCATCTCTGCATTGCTTGAATTCTCTCTCATGGGTATATCCGCAAAGAAAGAAAACACAC
CGCAACCTCCTAACAAGGAAGCTTATCCTCCTGCTCCGCTTCCATCTATTGAAGAGAAGCTTAATGATCTCCAGAAGGAG
GTTCATCAGATGTCTGTTGAGAGAGAGACTTTCAAGCTTGAGATGATGAGTGCAGAGGCTATGATCAGTATTCTCCAGTC
GAGGATCGATGCACTTCGCCAGGAGAACGATGAGCTGAGGAAGAACAACGCCACCAAGGGACAAGCGGTGCTCTAA