Details for Kale Locus Bo5g137330

Position : C5 ( 5`- 42766374 .. 42766904 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137330

Protein [Map View]
MRHSNFTHVCIYMYAKTQTHITSPSTSNKFSTSTQKRFSEHKHTFTDMDDLELLQDLSQFNFPATIKIPSKTSKDNKDGD
GDNDEVFSCSTPTSQEHKIPSVHDSPPPPPRKPRALPSKPSPTAALMIRSCKRKLLVSTPEIIMNKEEIDRFFSSVYSDT
STTAKRRRRYLYCARR*

DNA
ATGCGACATTCTAACTTCACGCATGTGTGCATATACATGTATGCAAAGACACAAACACATATAACAAGCCCCTCTACATC
CAACAAGTTTTCTACATCCACACAAAAAAGGTTTTCCGAACATAAGCACACATTTACAGACATGGATGATCTTGAGTTAT
TACAAGATCTGTCCCAATTCAACTTCCCAGCAACCATCAAGATCCCATCTAAAACCTCTAAAGACAACAAAGACGGCGAT
GGTGATAACGACGAGGTCTTTAGCTGCAGCACACCCACATCTCAAGAACACAAGATTCCTTCTGTCCACGATTCTCCACC
TCCCCCGCCGCGAAAACCTCGTGCACTGCCTTCAAAACCGTCGCCAACAGCGGCTCTGATGATCAGATCGTGTAAGAGGA
AGCTCTTAGTGTCAACTCCTGAGATTATCATGAACAAGGAAGAGATTGACCGTTTCTTCTCCTCTGTCTATAGTGACACG
TCAACGACGGCTAAACGGCGGAGACGTTATCTTTATTGTGCGCGAAGATGA