Details for Kale Locus Bo5g137320

Position : C5 ( 5`- 42747164 .. 42752970 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137320

Protein [Map View]
MENMISCKENLQGMTMEVALEDNNLMEKVLPPDEQEIDVELEAKEKKYLRGEGANLETLKDKKLKTQLASREKLYGKSAK
AAAKIEKWLLPASAGYLETDGLEKTWRVKQTDIAKEVDILSSRNQYDIVLPDFGPYKLDFTASGRHMLAGGRKGHLALVD
MMSMNLIKEIQVRETVRDVTFLHNDQFFAAAQKKYSYIYARDGTELHCLKERGPVARLRFLKNHFLLASVNKIGQLHYQD
VTYGDMVASIRTGKGRTDVMEVNPYNGVVALGHSGGTVTMWKPTSQAPLVQMQCHPGPVSSVAFHPNGHLMATSGKERKL
KIWDLRKFEEVQTIHGFHAKTLSFSQKGLLAAGTGSFVQVLGDSSGDYSRYMSHSMVKGYQIEKVMFRPYEDVLGIGHSM
GWSSVLIPGSGEPNFDSWVANPFETTKQRREKEVHLLLDKLPPETIMLDPSKIGAMRPSRRKERPTRGEIEAEKEVAVEA
AKGVELKKKTKGRNKPSKRTKKKKELVENVKKTFPEQEQGAAGKKRRIGEDAAADLPSSLKRRKLMTMEDEFDSKLSLQG
NASNVEGSISRSKSFAFKAPQENFTVQDFELDKIYGVGSYSKVVRATKKKDGGVYALKIMDKKFITKENKTAYVKLERIV
LDQLDHPGIVKLFFTFQDNFSLYMALESCEGGELFDQITRKGCLSEDEARFYGAEVVDALEYIHTMGLIHRDIKPENLLL
TSDGHIKIADFGSVKPMQDSQITLLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGCTLYQMLSGTSPFKDA
SEWLIFQRIIARDLKFPNHFSEAARDLIDRLLDTDPSRRPGAGPEGYASLKRHPFFKGVDWKKPRSQTPPKLAPDPSSQS
ASPERDGSPWNPTHVGDASAMQNNGPSSTSESSGSITRLASIDSFDSRWQQFLEPGESVIMLSAVKKLRKITSKKVQLIL
TNKPRLIYVDPSKLVAKGNIIWSDNSSDLNVQISSPSHFKICTPKKVLSIEDSKQRALQWRKAIETLQNR*

DNA
ATGGAAAACATGATAAGTTGTAAGGAGAACTTGCAAGGGATGACGATGGAGGTCGCTTTAGAGGATAACAATCTCATGGA
GAAGGTCTTGCCTCCTGATGAGCAGGAGATCGATGTTGAGTTGGAGGCTAAAGAAAAGAAGTATCTTAGAGGAGAAGGTG
CTAACTTAGAGACGTTGAAAGATAAGAAACTAAAGACTCAACTTGCTTCACGAGAAAAGTTGTATGGGAAGTCTGCAAAA
GCTGCTGCTAAAATCGAGAAGTGGCTCTTGCCGGCTTCAGCAGGGTACTTGGAGACTGATGGTTTAGAGAAGACATGGCG
GGTCAAGCAGACAGATATTGCCAAAGAAGTTGATATATTAAGCTCAAGAAACCAATATGACATTGTGCTCCCAGATTTTG
GCCCGTACAAACTCGATTTTACTGCAAGTGGACGGCATATGCTAGCTGGTGGTCGCAAAGGCCACCTTGCTCTTGTAGAC
ATGATGAGTATGAACTTAATTAAAGAGATCCAGGTAAGAGAAACAGTACGTGATGTTACATTCCTCCACAATGACCAATT
CTTTGCAGCTGCCCAGAAGAAGTATTCTTATATTTATGCGAGAGATGGAACTGAGCTCCATTGTTTGAAGGAACGTGGTC
CAGTGGCTAGACTCAGGTTCCTAAAGAACCATTTCCTCCTCGCATCAGTGAACAAAATCGGACAGCTACACTACCAAGAC
GTAACCTACGGAGACATGGTAGCCAGTATCCGAACAGGCAAAGGCAGAACAGATGTAATGGAAGTGAATCCTTACAACGG
TGTTGTCGCCTTGGGACACTCTGGTGGAACCGTCACAATGTGGAAACCAACAAGCCAAGCACCTCTAGTCCAAATGCAGT
GCCACCCTGGTCCAGTCTCCTCCGTCGCGTTCCACCCAAACGGCCACCTCATGGCTACGTCAGGCAAAGAGCGCAAACTC
AAGATCTGGGATCTCCGCAAATTCGAGGAGGTTCAGACCATCCACGGCTTCCACGCCAAGACGCTGAGTTTCAGCCAGAA
AGGTTTGCTAGCAGCTGGAACCGGATCGTTCGTTCAGGTTCTAGGAGACTCGAGCGGTGACTATAGCAGATACATGAGCC
ACTCGATGGTGAAAGGCTACCAGATCGAGAAGGTGATGTTCAGACCGTACGAGGACGTTCTCGGGATCGGTCACTCGATG
GGATGGTCCAGCGTTCTCATTCCAGGGTCTGGAGAGCCGAACTTCGATTCCTGGGTGGCTAACCCGTTCGAAACGACGAA
GCAGAGGCGGGAGAAGGAAGTGCACTTGCTGCTCGATAAGCTCCCGCCCGAGACGATCATGCTGGATCCTTCTAAGATCG
GTGCGATGAGGCCTTCGAGGAGGAAGGAGAGGCCGACGAGAGGAGAGATTGAAGCTGAGAAAGAGGTGGCGGTAGAAGCG
GCGAAGGGGGTTGAGCTGAAGAAGAAGACTAAAGGAAGGAATAAACCGAGTAAGAGGACTAAGAAGAAGAAAGAGTTGGT
GGAGAACGTGAAGAAGACGTTCCCGGAGCAAGAGCAGGGTGCTGCTGGTAAGAAGAGAAGGATCGGTGAAGATGCTGCGG
CAGATCTGCCATCAAGTTTGAAAAGAAGAAAGTTGATGACAATGGAGGATGAATTTGATTCAAAGCTTTCCCTTCAAGGG
AATGCATCAAATGTTGAAGGCAGCATATCAAGAAGCAAGAGCTTCGCATTCAAGGCTCCTCAAGAGAATTTCACCGTCCA
AGATTTCGAGCTCGACAAGATCTATGGCGTTGGCTCTTATTCAAAGGTTGTTAGGGCGACGAAGAAGAAGGATGGAGGCG
TGTACGCGTTGAAGATCATGGACAAAAAGTTTATAACCAAGGAGAATAAAACAGCTTATGTCAAGCTTGAGAGGATTGTT
CTTGATCAACTCGACCATCCTGGGATTGTCAAACTCTTCTTTACATTTCAAGATAACTTCTCTCTATACATGGCGCTTGA
ATCTTGTGAAGGTGGGGAGCTTTTTGACCAAATCACCCGAAAAGGTTGTCTATCAGAGGATGAAGCTCGGTTCTATGGTG
CAGAAGTTGTGGATGCTCTTGAGTATATACATACTATGGGACTGATACATAGAGATATTAAGCCGGAGAATCTGTTGCTG
ACTTCAGATGGACACATTAAGATTGCTGATTTTGGTAGTGTAAAGCCTATGCAAGACAGCCAGATCACTCTACTTCCTAA
TGCAGCTTCCGATGATAAGGCCTGCACTTTTGTCGGTACGGCTGCATATGTTCCTCCTGAAGTTCTCAACTCCTCTCCAG
CAACTTTCGGAAACGATCTCTGGGCACTGGGCTGCACTCTGTACCAAATGCTATCAGGAACATCTCCATTCAAAGATGCA
AGTGAATGGCTGATTTTCCAAAGAATTATAGCTAGAGACTTAAAGTTCCCAAATCATTTCTCAGAAGCAGCAAGAGACCT
CATCGACCGGTTGCTGGATACAGATCCTAGTAGAAGACCAGGAGCTGGGCCAGAAGGTTATGCTTCTCTCAAGAGACATC
CTTTCTTCAAAGGAGTTGATTGGAAAAAACCAAGATCACAAACTCCTCCCAAACTAGCTCCAGATCCTTCGTCTCAGTCA
GCATCTCCTGAGAGAGACGGTTCTCCATGGAATCCAACACATGTTGGAGATGCCTCAGCCATGCAGAACAATGGTCCCTC
TTCAACTTCTGAATCCTCTGGTTCCATAACAAGGCTTGCCTCCATAGACTCATTTGATTCGAGATGGCAACAGTTTCTTG
AACCGGGAGAATCGGTTATAATGTTATCAGCAGTGAAGAAGCTACGGAAAATCACGAGTAAGAAAGTGCAGCTGATACTC
ACCAACAAACCGAGACTGATCTACGTTGATCCATCAAAGCTTGTTGCCAAAGGGAACATCATCTGGTCTGATAACTCCAG
TGACCTCAACGTTCAAATCTCAAGTCCTTCCCATTTCAAGATTTGCACACCGAAGAAGGTTCTATCGATTGAAGACTCGA
AACAACGAGCTTTGCAGTGGAGAAAGGCAATTGAAACTCTTCAAAACCGTTGA