Details for Kale Locus Bo5g137280

Position : C5 ( 5`- 42732662 .. 42734348 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137280

Protein [Map View]
MEATDGIWGEIERSESYLVCSMYEEAVSLSSSILKGIFGNVETLGDHQLLDMLESAGMVLVQSLHGLGRAGEIVNELRQV
FGEIAAIPVQVLLTGICLQISNGSYSGVREVLEEFFSLWVYKDNHYVLSDAGLSEKVFHGKILLDVDEYMEVVELYTFGV
LGKDTNDVGLAVSWVEQAPLPEERRQGLLRRLDSLLSLKSPKVQEATSLEENSSYDVVNSSNKSLANEKNDYILKLSKQH
EPWSSRPLSLKFGNTRFSMSRGKVAISLVGLIICYALQRKRAALIRIIRRQMESTKKAIVDFWKLAFSYQVNPLAAIQPI
PSTTT*

DNA
ATGGAGGCCACTGATGGTATTTGGGGTGAAATCGAACGTTCTGAGAGCTACCTAGTCTGCTCTATGTATGAAGAGGCAGT
CTCATTATCTTCCTCCATACTAAAAGGAATCTTTGGCAACGTTGAAACTCTTGGTGATCATCAGTTGCTTGACATGCTTG
AATCTGCTGGCATGGTTCTAGTCCAATCCTTGCATGGACTCGGCAGGGCAGGTGAGATTGTAAATGAGCTAAGACAAGTG
TTTGGCGAAATTGCAGCTATTCCTGTTCAAGTTCTTCTCACTGGAATATGTCTTCAAATATCAAACGGTTCCTACTCCGG
TGTACGTGAGGTTCTGGAAGAGTTCTTTAGCTTATGGGTTTACAAGGACAACCACTATGTCCTAAGTGATGCTGGATTAA
GTGAAAAAGTGTTCCATGGGAAAATACTCTTGGATGTTGATGAGTACATGGAAGTTGTGGAGCTGTATACCTTTGGAGTT
CTTGGAAAAGACACAAACGACGTGGGTCTAGCGGTTTCATGGGTTGAGCAAGCTCCATTGCCTGAGGAAAGACGACAGGG
ACTTTTAAGAAGATTGGATTCTTTACTTTCTCTCAAATCACCAAAAGTTCAAGAGGCTACTTCTTTAGAGGAAAACTCTT
CTTACGATGTGGTGAATAGCAGCAACAAGTCTTTGGCTAATGAAAAGAATGATTATATCCTGAAACTCTCTAAACAACAT
GAACCTTGGTCGTCTCGTCCTCTTAGCCTAAAGTTTGGTAATACCCGATTCAGCATGTCCAGGGGGAAAGTTGCTATAAG
CCTTGTTGGATTAATCATATGCTATGCTTTACAAAGAAAACGAGCTGCTTTAATACGGATCATTCGCAGACAAATGGAGT
CCACGAAGAAAGCAATTGTAGATTTCTGGAAGCTTGCGTTTTCGTACCAAGTGAATCCTCTTGCAGCTATTCAACCAATA
CCAAGCACCACAACTTGA