Details for Kale Locus Bo5g137250

Position : C5 ( 5`- 42727268 .. 42728314 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137250

Protein [Map View]
MAWWEQWGRDEDKMFEEALVLTENVPNRFEAIASYLEMPLEVVKHYYDALVRDVELIESDRYGTIDYQDHADGILSPETK
HMDKDNKRGRPWTAKEHGDFLKGLDEFGRGDWKSVSREYVKTRSAKQVASHAQKYFQRQDMENHAKKRSSINDMTLADVN
DADDVPAPRSDSEATMDPAHFGQQTP*

DNA
ATGGCTTGGTGGGAGCAGTGGGGGAGGGACGAAGACAAAATGTTCGAGGAAGCGCTGGTGCTCACGGAGAACGTTCCTAA
CAGGTTTGAGGCTATCGCCAGCTATCTTGAGATGCCGCTCGAGGTTGTGAAGCACTACTACGACGCTTTGGTACGCGACG
TTGAACTTATCGAATCGGATCGCTATGGTACTATCGATTATCAAGATCACGCAGATGGAATCCTCTCACCCGAGACTAAA
CACATGGATAAAGATAACAAGAGAGGAAGACCGTGGACAGCGAAGGAGCACGGAGACTTTCTGAAAGGATTAGACGAGTT
TGGGAGAGGAGATTGGAAGAGTGTATCGAGAGAGTATGTGAAGACAAGGTCTGCAAAGCAAGTCGCAAGCCATGCACAAA
AGTATTTCCAGAGGCAAGACATGGAGAATCATGCAAAGAAGCGCTCCAGTATCAATGACATGACTTTGGCTGATGTTAAT
GATGCTGATGATGTACCCGCCCCTCGATCCGACTCGGAAGCTACGATGGACCCGGCACATTTTGGTCAGCAGACGCCTTA
G