Details for Kale Locus Bo5g137200

Position : C5 ( 5`- 42707639 .. 42713426 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137200

Protein [Map View]
MSASTVSLTANPTAAIRRTPVISGDKKSTLDLPPSESHANTNQDPIRGEAAAERSNSYDVGPVIRKSGSSTAAGTKSTTA
QRRTRKVQGTKNEKTPWTRVVRVFAKQLGALLLLAGLIQLVRRVVIKETPLSSHSSFPIETEMGLSELESRIAAVDGLVR
TTAKMMQVQVEFLDKKMGGETRALRETMESTSSALEAELKKVDSRVDRLQASVEEVNSKPLVSREELERVYEELKKSKVD
ESSFSDVSIDELRAYAREIVEKEIGKHAADGLGRVDYALASGGAFVMDHSDPFLVGNWFGTSRRRVHSKAVKMLTPSFGE
PGQCFPLKGSNGFVQVRLRAPVVPEAVTLEHVSKAVAYDRTSAPKDCRVSGWLEDEKDMESETRLLLTEFTYDLDRSNAQ
TFDIAESANSGLVNTVRLDFTSNHGSDSHTCIYRFRVHGRELDSVSATVTHISALPPPFFFVSPPSQKSHERIKNITTRS
QSAKSFTTMSWPTESELTAIKEAVSKMTGRDTEEVRVVVAPYRICPLGAHIDHQGGAVSAMTINKGILLGFVPSGDTQVQ
LRSAQFEGEVCFRVDEIQHPVGLANKNGAPKDQSIWGTYARGALYALQTSNKNVKQGIVGCISGSDGLDSSGLSSSAAVG
VAYLLALENANEMTVSATENIEYDRLIENGYLGLRNGILDQSAILLSSYGCLTYMDCKTMDHKLIQGPELEKPFRILLAF
SGLRQALTTNPGYNLRVAECQEAAKVLLTASGNSELEPTLCNVEHAVYEAHKLEERSITSRKTCGLLKANALEFFCRRLE
AWATGNLEEFGKLISASGLSSIENYECGAEPLIQLYKILLKAPGVYGARFSGAGFRGCCVAFVDAEKAEEAASYVKDEYE
KAQPEFAKKLNGGKPVLICEAGDSARVL*

DNA
ATGTCGGCATCAACGGTGTCTCTCACCGCTAACCCGACGGCGGCGATTAGACGGACGCCGGTTATCTCCGGCGATAAGAA
ATCCACCCTAGATCTCCCGCCGAGCGAATCTCATGCAAATACGAACCAGGATCCGATTCGCGGCGAGGCCGCCGCTGAGA
GATCCAACAGTTACGACGTGGGTCCGGTGATAAGAAAGTCGGGATCCTCCACCGCGGCGGGGACCAAATCGACCACCGCG
CAGCGACGTACGCGGAAGGTACAGGGGACTAAGAACGAGAAAACGCCGTGGACGAGAGTGGTTAGAGTCTTCGCGAAGCA
GCTCGGTGCTCTTCTGTTACTCGCTGGGTTGATTCAATTGGTTAGGAGAGTGGTTATAAAGGAGACGCCTTTATCTTCTC
ACTCGAGTTTCCCGATCGAGACGGAGATGGGTTTGTCGGAATTAGAGAGCAGGATTGCGGCGGTGGATGGTTTGGTTAGG
ACCACGGCGAAGATGATGCAGGTGCAAGTGGAGTTTCTCGATAAGAAGATGGGAGGGGAAACGAGAGCACTTAGGGAGAC
GATGGAATCAACGTCTTCTGCGTTGGAGGCTGAGCTGAAGAAGGTGGATTCTAGGGTAGATAGGTTACAGGCTTCCGTAG
AGGAAGTCAATTCGAAACCTTTGGTGTCTAGAGAGGAGTTAGAGAGGGTTTACGAGGAATTGAAGAAGAGTAAGGTCGAT
GAATCTTCTTTTAGCGATGTTAGCATCGATGAGTTGAGGGCTTATGCGCGTGAGATAGTGGAGAAAGAGATTGGTAAGCA
TGCTGCGGATGGGCTCGGACGAGTTGACTATGCGTTAGCGTCTGGTGGGGCTTTTGTGATGGATCATTCGGATCCGTTTC
TTGTGGGGAATTGGTTTGGGACAAGCAGGCGGCGAGTTCATAGCAAAGCGGTTAAGATGTTGACGCCGAGTTTCGGGGAG
CCTGGTCAGTGTTTCCCTTTGAAAGGAAGTAATGGCTTTGTTCAAGTCAGGCTAAGAGCACCGGTAGTACCAGAGGCTGT
TACTTTGGAACATGTCTCTAAGGCTGTGGCGTATGATAGAACGAGCGCCCCAAAGGATTGTCGTGTATCAGGATGGCTAG
AAGACGAAAAAGATATGGAGAGTGAGACAAGGCTCCTTCTAACAGAGTTCACTTACGACTTGGACAGGTCAAACGCACAA
ACATTCGACATTGCGGAGTCTGCTAACTCGGGACTCGTCAACACTGTAAGGCTAGACTTCACATCAAACCATGGAAGCGA
TTCACACACTTGCATCTACCGGTTCAGGGTTCATGGCCGTGAACTAGACTCAGTCTCTGCTACGGTCACTCACATCTCGG
CTCTTCCTCCACCATTCTTCTTCGTCTCTCCTCCATCCCAGAAATCACACGAGAGAATCAAAAACATCACCACCAGATCT
CAATCTGCGAAAAGCTTCACGACAATGTCTTGGCCTACGGAATCCGAGTTAACTGCCATTAAAGAGGCAGTGTCCAAGAT
GACCGGGAGAGACACAGAGGAAGTTCGCGTTGTGGTAGCGCCGTATCGTATATGTCCTTTGGGGGCTCACATTGATCACC
AGGGTGGAGCTGTATCGGCTATGACGATTAATAAAGGGATCCTTCTTGGTTTTGTTCCGTCGGGCGATACTCAGGTCCAG
TTGCGTTCTGCACAATTTGAAGGAGAAGTATGTTTCAGAGTAGATGAAATCCAGCACCCAGTAGGCCTAGCAAATAAAAA
TGGTGCACCAAAGGATCAAAGCATCTGGGGCACTTATGCCAGAGGAGCGCTTTATGCGTTACAGACGAGCAATAAGAATG
TCAAACAGGGCATTGTTGGCTGCATCAGTGGCTCGGATGGGCTAGACAGTTCTGGGCTTAGTTCATCGGCTGCTGTTGGT
GTGGCATACCTGCTAGCTTTAGAGAATGCAAACGAAATGACTGTATCCGCAACAGAAAATATAGAATATGACAGGCTTAT
TGAGAATGGGTATCTGGGTCTGCGGAATGGAATTTTGGATCAATCAGCTATTTTGCTATCGAGTTATGGGTGTCTAACAT
ACATGGACTGCAAGACTATGGACCACAAGCTCATACAGGGTCCTGAACTGGAGAAACCATTCAGGATATTGTTAGCATTC
TCAGGCCTGAGGCAGGCATTGACCACCAACCCAGGATATAATCTGCGAGTTGCTGAATGCCAAGAAGCTGCGAAAGTTCT
CTTGACTGCATCTGGGAACAGCGAGCTGGAACCTACCTTGTGCAATGTTGAGCATGCGGTCTATGAAGCTCACAAGCTAG
AAGAGCGGAGCATTACTTCTCGGAAAACATGCGGGTTACTAAAGGCAAATGCTCTTGAATTCTTTTGTAGAAGACTGGAA
GCGTGGGCTACAGGCAATCTTGAAGAATTTGGAAAGCTAATTTCAGCGTCCGGCTTGAGCTCTATTGAGAATTACGAATG
CGGTGCGGAGCCACTGATTCAGCTATACAAGATTCTACTGAAGGCACCTGGTGTATATGGAGCTCGATTCAGTGGTGCAG
GCTTCAGGGGATGTTGTGTGGCCTTTGTGGATGCAGAGAAAGCTGAGGAAGCTGCTTCATATGTGAAGGATGAATATGAA
AAGGCCCAACCCGAGTTTGCCAAGAAGCTGAATGGAGGTAAACCTGTTCTCATCTGCGAAGCAGGTGACTCTGCTCGTGT
TCTCTGA