Details for Kale Locus Bo5g137180

Position : C5 ( 5`- 42701794 .. 42703413 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137180

Protein [Map View]
MSGEDRISALHDDLLLKILSEIPTKDVVTTMVLSKRWRFVWTKVHKLEYKDTRKEGNSRVWWLIEKSLQLHKATVLESLH
IQVEHQFCDDADVGKCVSYAVDHNVRELALIIPPQPMILLLPSNVYTSKTLVKLTLSCRTLFIDVPSLPCLPSLQRLALL
NVVYKDENSHVRLLSNCPALRHLEVQRNKSDNVTSFIVKVPSLKSFRYTQHKRASGRSLVLDSPGLRRLTLIDPHGDLDS
IQNMPHLDWAHVFLIIPYPKDDKFLRSFSSVKVLRLSLRNVECCSTIKFSRLMKVTLHLCCFDDFMCSLEPLLLFLHNSP
ILKVLEINYDVALCSNGVPLSWNRPSSVPVCLLSHLEIFVWKEFAGRRQERAFVAYILANSKRLKTAVFSPTYNLYEKEK
EKMMELLKSMYRASASSQLLRLLN*

DNA
ATGTCCGGTGAAGACAGGATCAGTGCGTTGCATGACGATTTGCTGCTGAAGATATTGTCTGAAATCCCAACAAAAGATGT
AGTGACCACCATGGTTTTGTCCAAACGATGGCGTTTTGTCTGGACGAAGGTGCATAAACTTGAGTACAAGGATACAAGGA
AAGAAGGGAATAGCAGAGTTTGGTGGTTAATTGAAAAGTCTTTGCAACTCCACAAAGCAACTGTACTAGAAAGCTTGCAT
ATCCAAGTTGAACATCAGTTTTGCGACGATGCAGATGTAGGAAAGTGCGTTTCATACGCTGTTGACCACAACGTTCGAGA
GCTAGCTCTTATTATACCACCTCAACCAATGATCCTACTACTACCATCGAACGTTTACACCTCAAAAACGCTAGTGAAAC
TGACTCTATCATGTAGGACTCTCTTCATTGATGTCCCTTCCCTACCTTGCCTTCCTTCGCTTCAGAGGCTGGCCCTTCTC
AATGTTGTGTATAAAGATGAAAACTCTCATGTTAGGCTTCTATCGAATTGCCCTGCGCTCAGACATTTGGAAGTGCAGCG
AAACAAGAGTGACAATGTGACAAGTTTCATTGTGAAAGTTCCTTCCTTAAAGAGTTTTAGATACACGCAACACAAAAGAG
CTTCTGGTAGGTCCTTGGTTTTAGACTCCCCTGGATTACGACGCCTTACTTTAATTGATCCGCATGGAGACTTAGACTCG
ATCCAGAATATGCCTCACCTTGACTGGGCTCATGTTTTTCTCATTATTCCATACCCGAAAGACGACAAGTTTCTGAGATC
TTTTTCCTCTGTCAAGGTTCTCCGTTTGAGTCTAAGAAACGTTGAATGTTGTAGCACCATTAAGTTCTCTCGGCTCATGA
AGGTTACGCTGCATCTTTGTTGCTTTGATGACTTCATGTGTTCGTTGGAACCACTTTTGCTTTTCCTTCATAACTCTCCT
ATACTAAAAGTTCTTGAGATCAACTATGATGTGGCTCTTTGCTCTAATGGTGTCCCACTTTCGTGGAACAGACCAAGTTC
TGTACCGGTATGCTTGTTGTCCCATCTCGAGATCTTTGTATGGAAAGAGTTTGCAGGAAGAAGGCAAGAGAGAGCGTTCG
TGGCGTACATCCTTGCAAACTCAAAGCGGCTAAAGACGGCTGTATTTTCTCCCACATACAATCTCTACGAAAAAGAGAAA
GAGAAGATGATGGAGCTGTTAAAATCTATGTATAGGGCTTCAGCATCTTCTCAGCTTCTGCGCTTGCTAAACTAG