Details for Kale Locus Bo5g137140

Position : C5 ( 5`- 42687555 .. 42689247 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137140

Protein [Map View]
MAAAAAAAMTEKEAMLDPFLVEALQNPRHRLTILRMELDIQKFFQNPDQLQFEFSPFPTSYLRLAAHRVAQHYGLVTMAL
DNGGGAVDGSDNRILVTKTAESRFPHVCLSEIPVKQPENGRPEGGFKIAIKARPKRGSGSGGSGSGVQQNLQRSVEERKE
EYDKARARIFNSPGSSDSEDSSSLRAPPPPPEVKNTSINRNEAEVAVSNNSPDAGGSRESGRTSVAIIRDREKDRYDPDY
DRSYDRYVVDPAYRYVRVMPSGQSFNPMPMHIPFHDGGFPQMPRGHQANLNYGHPFNPAMSPFINNPAAYTPWPNSPAMN
YAHSLNGPDTNLFRHPSASNP*

DNA
ATGGCCGCCGCCGCCGCCGCCGCTATGACAGAGAAGGAAGCTATGTTGGATCCTTTTTTGGTCGAAGCTCTCCAGAATCC
TCGTCATCGTCTCACCATTTTGCGGATGGAGCTTGATATACAAAAGTTCTTTCAAAACCCTGATCAGCTCCAGTTCGAGT
TCTCTCCTTTCCCAACCTCTTACCTGCGTCTCGCCGCACATCGAGTTGCTCAGCATTATGGACTAGTGACCATGGCTTTG
GACAACGGTGGTGGCGCAGTAGATGGATCCGACAACAGAATCCTTGTGACCAAAACAGCGGAGAGCAGGTTTCCTCACGT
CTGCTTATCCGAAATCCCTGTTAAGCAACCGGAGAACGGTAGGCCCGAGGGTGGTTTCAAGATTGCGATCAAGGCGAGGC
CCAAGAGAGGATCTGGCTCCGGAGGTAGCGGATCAGGAGTGCAGCAGAATCTTCAGAGAAGCGTTGAGGAGAGGAAAGAA
GAGTACGATAAGGCCAGAGCTCGGATCTTTAACAGCCCTGGTAGTTCCGACTCTGAAGATTCTTCGTCGTTACGAGCTCC
TCCTCCTCCTCCTGAAGTGAAAAACACAAGTATAAACCGCAATGAGGCTGAGGTGGCGGTGAGTAATAATTCTCCTGATG
CTGGTGGTTCTCGAGAATCTGGAAGGACTTCTGTAGCCATTATCAGAGATAGAGAGAAAGATCGATATGATCCTGATTAT
GACAGGAGCTATGACAGGTATGTCGTGGATCCCGCATACAGGTACGTTAGGGTTATGCCGTCTGGCCAAAGCTTTAATCC
GATGCCAATGCACATTCCCTTTCACGATGGAGGTTTCCCGCAGATGCCAAGAGGTCATCAAGCTAATCTAAACTACGGTC
ATCCGTTTAATCCTGCCATGAGTCCCTTTATTAATAACCCGGCTGCTTATACGCCGTGGCCAAACTCACCAGCTATGAAC
TATGCGCATTCGTTGAACGGCCCAGACACGAATCTTTTCAGGCATCCTTCTGCGAGCAATCCCTGA