Details for Kale Locus Bo5g137130

Position : C5 ( 5`- 42684687 .. 42686055 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137130

Protein [Map View]
MTISPLLFIGLICLAGGGSLLPAAEAIWLTVPSSGERCVYEEIHANVVVVVDYLCIDQNNIGLGPTVDVRVNSAYGKELY
KKTNETHGQFAFTTSESGTYLACFLIHHDQTHYTASNSTAIVNIDWKMGIQTKDWDAVAKKEKIEGVELELRKSSERITE
IRANILYLKFRESAMREVNEKTNKRVAQLSFVSLGLCLIVSLFQVWHLKRFFLKKKLI*

DNA
ATGACAATCTCACCGTTACTATTCATTGGTTTGATTTGCCTCGCAGGCGGTGGCTCTCTTCTACCGGCGGCGGAAGCGAT
ATGGTTAACGGTTCCAAGTTCAGGCGAGAGATGTGTCTACGAAGAGATCCATGCCAATGTGGTCGTTGTCGTCGATTACC
TTTGCATCGATCAAAATAACATCGGACTTGGTCCCACAGTTGATGTCCGGGTAAATTCAGCTTACGGCAAAGAACTGTAC
AAGAAAACAAACGAGACGCACGGTCAGTTTGCGTTTACAACGAGCGAGTCCGGAACATACTTAGCTTGTTTTTTGATACA
CCACGATCAGACACATTACACAGCCAGCAATAGCACTGCTATCGTCAATATCGACTGGAAGATGGGTATCCAAACCAAAG
ATTGGGATGCTGTTGCTAAGAAAGAAAAGATCGAGGGTGTGGAACTTGAGCTTCGAAAATCTTCTGAACGTATTACTGAA
ATTAGGGCAAACATTCTCTATCTAAAATTCAGGGAATCAGCTATGAGGGAGGTAAACGAGAAGACTAACAAGAGGGTTGC
GCAGCTCAGCTTTGTTTCTTTAGGGCTCTGCCTTATCGTTTCACTTTTTCAAGTTTGGCATCTCAAACGCTTCTTCCTCA
AGAAGAAGCTTATCTAA