Details for Kale Locus Bo5g137120

Position : C5 ( 5`- 42671410 .. 42672003 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137120

Protein [Map View]
MTSRKNTHWCNTCRRGIRLQGEDLRRGGACIHCGNTFLERLCENVDLNPFDLFGLAIQESRNRRDNRRRSVLENQLSFQE
LFNRLSAQDRRGPPPASLTVINSMPKIKIRKKHLGLDSCCPVCQDRFEVGSFARKMPCKHIYHSECIVPWLVQHNSCPVC
RKELPEDGNNGRKNPFLYLWPFTSSGAASNYNGPPFH*

DNA
ATGACTAGCCGAAAAAACACGCATTGGTGTAATACTTGTAGACGAGGAATCCGTCTTCAAGGAGAAGACCTAAGAAGAGG
AGGAGCTTGCATTCACTGCGGTAACACCTTTCTCGAAAGGCTCTGTGAGAATGTTGATCTAAACCCGTTTGATTTATTCG
GTTTAGCCATTCAAGAATCTCGTAACCGTCGCGACAACAGAAGAAGATCGGTTCTTGAAAACCAATTGAGTTTTCAAGAG
TTGTTTAACCGGCTCTCAGCACAAGACCGCCGTGGTCCACCTCCAGCCTCACTAACCGTGATCAACTCAATGCCAAAGAT
CAAGATCAGGAAGAAGCATCTCGGTTTGGATTCGTGTTGCCCGGTTTGCCAAGACCGGTTTGAAGTCGGGTCGTTTGCAA
GAAAGATGCCGTGTAAACATATCTATCATTCTGAATGTATAGTCCCGTGGCTAGTCCAGCATAATTCTTGTCCAGTGTGT
CGCAAAGAGCTGCCAGAAGACGGCAATAATGGTCGAAAAAATCCCTTCTTGTATCTGTGGCCGTTTACATCCTCTGGTGC
GGCCTCAAACTATAATGGACCACCTTTTCATTGA