Details for Kale Locus Bo5g137110

Position : C5 ( 5`- 42662245 .. 42664396 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137110

Protein [Map View]
KGVSYLKKRDGTQSGNIITQAFVLLLYHHHLSRNYEPTMNLLNTTTRIFFLHQPKQSIITFSSLSSNAKLSLDSSRTNFQ
MPCLISGQSFRRPGKRFIVSNAASPSLSGSPDQFLDGGAQTKEETVAETEQDPMNLADPDSCFCEFQGVNIHHKVFDPRT
LSDDAPITNVDAQGTTPKVEFPMILLHGFGASVFSWNRVMKPLARLVRSKVLAFDRPAFGLTSRILHPFSGVTNDAKPLN
PYSMVYSVLTTLYFIDFLAADKAILVGHSAGCLVAVDSYFESPERVAALILVAPAIFAPRPVNTAAGAGDNRGENGPRSK
FLGTLVELSKVIIGAISRALTGMASMLSSLYKKALAAFLRSYLGVMLVRMAINKFGVTAVRNAWYDSKQVTDHVVQGYTK
PLKAKGWDKALVEFTVATLTDNNGSEKKPPLSKRFQEIKCPVLIVTGDTDRIVPAWNAERLSRAIPGSVFEVIKKCGHLP
QEEKPDEFISVVAKFLGDVFGGSQRERQVDLKFQGSVS*

DNA
AAAGGAGTATCTTATTTAAAAAAGAGAGACGGAACACAATCTGGAAATATTATAACTCAAGCTTTTGTACTTTTGCTTTA
TCATCATCATCTGTCTCGTAATTACGAGCCAACAATGAATTTATTAAACACCACCACACGCATCTTCTTCTTACACCAAC
CAAAGCAGAGTATCATAACTTTCTCTTCCTTATCTTCCAATGCAAAGCTTAGTTTAGATTCCTCTAGAACCAACTTTCAG
ATGCCTTGCCTAATCTCCGGCCAATCCTTTCGCCGTCCGGGGAAACGTTTCATCGTCTCCAATGCTGCTTCTCCCTCTCT
CTCTGGCTCCCCAGATCAATTTCTTGATGGTGGTGCTCAGACCAAAGAGGAGACAGTAGCTGAAACAGAACAGGATCCAA
TGAACTTAGCTGATCCAGACAGCTGTTTCTGCGAGTTTCAAGGTGTTAACATACACCACAAAGTGTTTGATCCACGCACA
CTCTCTGATGATGCTCCCATCACAAACGTCGATGCTCAAGGAACAACCCCAAAAGTCGAGTTTCCTATGATTCTTTTACA
CGGCTTTGGCGCTTCTGTGTTCTCCTGGAACAGAGTCATGAAGCCTTTAGCTCGCCTTGTCCGTTCGAAAGTTCTCGCCT
TTGATAGACCCGCATTTGGACTGACTTCTCGGATCCTTCACCCGTTTAGTGGTGTTACCAATGATGCAAAGCCGTTGAAT
CCGTACTCCATGGTGTACTCCGTGCTAACCACGTTGTACTTCATCGACTTTCTTGCAGCCGATAAGGCCATTCTTGTAGG
GCATTCAGCAGGTTGCCTTGTAGCTGTAGATTCTTATTTTGAATCCCCAGAACGTGTTGCTGCACTCATTCTCGTCGCTC
CAGCTATATTTGCTCCTCGTCCAGTGAACACAGCTGCTGGTGCTGGAGATAACCGTGGCGAAAATGGTCCCAGGAGCAAG
TTTCTAGGGACTTTAGTTGAGTTAAGCAAAGTCATTATAGGAGCAATTTCGAGAGCTCTAACGGGAATGGCGAGTATGCT
GAGTTCTCTATACAAGAAAGCTTTGGCAGCTTTCCTCAGATCATATCTTGGAGTCATGCTGGTGAGAATGGCGATCAATA
AGTTCGGAGTAACAGCCGTTAGAAACGCTTGGTATGACTCAAAACAAGTGACTGATCACGTTGTTCAGGGCTATACAAAG
CCTCTAAAAGCAAAGGGATGGGACAAAGCTCTTGTTGAGTTCACCGTGGCTACATTAACGGATAACAATGGCTCAGAGAA
GAAACCTCCATTGTCGAAAAGGTTTCAAGAAATCAAATGTCCTGTTCTGATTGTCACCGGAGATACAGACCGGATTGTGC
CAGCATGGAACGCAGAGAGGCTGTCACGAGCCATCCCTGGATCGGTGTTTGAAGTGATTAAGAAATGTGGGCATCTTCCA
CAAGAGGAAAAGCCAGACGAGTTCATATCTGTTGTTGCAAAGTTTCTAGGGGATGTTTTTGGAGGGTCACAACGAGAGCG
ACAAGTGGACTTGAAGTTCCAAGGCAGTGTGTCATAA