Details for Kale Locus Bo5g137100

Position : C5 ( 5`- 42654465 .. 42661411 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137100

Protein [Map View]
MLGWHLTHGKGKEVEHSVSDKEVPPNLNTRLISIQEVSGESSAASLEGQSVSSTISSGKRLPSPSRRIVDVAWKERVDVW
KMKQENGFSPVRSQSASERGVYDFNATINDSVDEALLSPSGSLLTEKHTSIDYLLGEPSQLAAVDIFVSTVDPLKEPPLV
TANTVLSIMAVDYPVDKVSCYVSDDGAAMLSFESLAETSEFARKWVPFCKKYSIEPRAPEWYFALKVDYLKDKVHPSFVK
DRRAMKREYARFKIRINALVSKAEKVPGEGWVVQDGTPWPGNNTRDHPGMIQVFLGQNGGLDAEGNELPRLVYVSRENRP
GFLHHKKAGAMNALVRVSAVLTNGPFLLNLDCDHYINNSKALREAMCFLMDPDLGKQVCYVQFPQRFDGIDKNDRYANRN
TIFFEINLRGFDGIQGPVYVGTGCVFNRTALYGYEPPVKPKHKRESVLSRLYGGSRKKGSKSKKGPDKKKSSKNSDSTIP
VVNIGDIEEGVEAPALDDDKTLLMSQIRLEQRFGQSDIFVASTLMEHGGFPLYATPENLLKEAIHVISCGYEDTTEWGTE
IGWIYGSVTEDILIGFKMHARGWRSIYCMPKLPAFKGSAPINLSDRLNQVLRWALGSIEILFSRHCPIWYGYGGRLKFLE
RFAYVNTTIYPITSIPLLMYCTLPAVCLFTNQFIIPEISNLASIWFLSLFLSIFATGVLEMRWSGVAHLFAVVQGLLKVL
AGIDTNFTVTSKASDRRRLGRALLDQMDDAFDPADDSADYKPFGSGCGYLLRAQQWVSDLGTSFWIIDESTGDSAVVDPV
DPEKVIQSAEQHSANIKFVLTTHHHWDHAGGNEKMKQLVPGIKVYGGSLDKVKGCTDAVDNGDTLSLGHDVNILALHTPC
HTKGHISYYVTGKDGETPAVFTGDTLFVAGCGKFFEGTAEQMHQSLCVTLASLPKPTQVYCGHEYTVKNLEFALTVEPNN
EKIQQKLSWARQQRQANLPTIPSTLEEELETNPFMRVNNPEIQEKLGCKSPIDTLREIRNKKDQWRG*

DNA
ATGCTTGGATGGCATCTTACACATGGGAAGGGGAAAGAGGTTGAGCACTCTGTTTCTGACAAAGAGGTCCCTCCAAATCT
TAATACTCGTCTCATTAGTATACAAGAGGTTTCTGGAGAGTCTTCTGCTGCTTCACTTGAAGGCCAATCTGTATCTTCTA
CTATATCTAGTGGAAAGCGGCTTCCCTCACCAAGCAGAAGGATTGTGGATGTAGCCTGGAAGGAGAGGGTTGACGTCTGG
AAAATGAAGCAGGAGAACGGATTCAGTCCTGTGAGATCTCAATCTGCTTCTGAAAGGGGTGTATATGATTTTAATGCCAC
CATTAATGACTCCGTTGATGAGGCTTTGCTTTCCCCAAGTGGTTCCCTGTTAACCGAGAAACATACCTCGATAGACTATC
TCTTAGGCGAACCATCACAATTAGCAGCTGTGGACATTTTTGTGAGTACTGTTGACCCTTTAAAGGAGCCTCCTCTGGTG
ACAGCCAATACAGTACTCTCTATCATGGCGGTTGATTACCCGGTGGACAAGGTGTCTTGTTATGTTTCTGACGATGGTGC
TGCTATGTTATCATTTGAGTCACTAGCAGAGACATCAGAGTTTGCTAGAAAATGGGTACCTTTCTGCAAGAAGTATAGTA
TTGAGCCTCGAGCACCAGAATGGTACTTTGCTTTGAAAGTTGATTACTTGAAGGATAAAGTTCATCCGTCATTTGTCAAA
GATCGCAGAGCTATGAAGAGGGAGTATGCGAGATTCAAGATCAGAATAAATGCACTTGTTTCCAAGGCTGAGAAAGTCCC
TGGAGAAGGTTGGGTTGTGCAAGATGGTACGCCATGGCCTGGAAACAACACAAGGGATCATCCAGGAATGATCCAGGTTT
TCTTAGGACAAAATGGTGGACTTGATGCAGAAGGCAACGAGCTTCCACGTTTGGTCTATGTTTCTAGAGAAAATAGACCA
GGGTTCCTGCACCATAAAAAGGCTGGTGCTATGAATGCACTTGTTAGAGTTTCAGCAGTCCTTACTAATGGACCTTTCTT
ATTGAATCTTGATTGTGATCATTACATAAATAACAGCAAGGCCTTGAGAGAGGCTATGTGCTTCCTAATGGATCCAGACC
TTGGGAAGCAAGTCTGTTATGTCCAGTTCCCTCAGAGGTTTGATGGTATTGACAAAAATGATAGATATGCTAACCGGAAC
ACCATCTTTTTCGAGATAAATTTGAGAGGCTTTGATGGGATCCAAGGACCTGTATATGTGGGAACTGGCTGTGTATTCAA
TAGAACTGCATTATATGGTTATGAACCTCCAGTTAAACCAAAACACAAGAGAGAAAGTGTATTATCTAGACTTTATGGAG
GATCTAGAAAGAAGGGATCCAAATCTAAAAAGGGTCCTGACAAGAAAAAATCTAGCAAGAACTCTGACTCAACTATTCCT
GTAGTCAACATTGGTGATATAGAAGAGGGAGTTGAAGCTCCTGCTTTAGATGATGACAAGACCCTCCTGATGTCGCAAAT
AAGACTGGAGCAGCGGTTTGGACAATCAGATATTTTTGTTGCTTCAACACTAATGGAACATGGAGGTTTTCCTCTCTATG
CTACTCCCGAAAACCTTCTCAAAGAAGCTATCCATGTCATTAGCTGTGGATACGAGGACACAACAGAGTGGGGAACTGAG
ATTGGGTGGATCTATGGTTCTGTAACAGAAGATATCCTCATCGGGTTCAAAATGCATGCACGTGGCTGGAGGTCGATTTA
CTGTATGCCTAAACTACCTGCATTCAAAGGATCTGCTCCTATTAATCTCTCTGATAGGTTGAACCAAGTGCTTAGGTGGG
CTCTAGGTTCAATAGAGATTCTCTTTAGTCGTCATTGTCCAATCTGGTATGGTTATGGAGGGAGGCTGAAGTTTCTTGAG
AGGTTTGCATATGTCAACACCACAATCTACCCAATCACATCCATTCCTCTCCTCATGTATTGCACATTGCCTGCCGTTTG
TCTCTTCACCAACCAATTCATCATTCCTGAGATAAGTAACTTGGCGAGCATATGGTTTCTTTCTCTCTTCCTTTCGATTT
TCGCCACGGGTGTGCTTGAGATGAGATGGAGTGGAGTGGCTCACTTGTTTGCAGTCGTCCAAGGACTTCTCAAAGTGCTG
GCCGGTATAGACACAAACTTCACAGTCACATCGAAAGCCTCGGACAGACGGCGACTCGGCCGAGCTTTACTTGATCAAAT
GGACGACGCTTTTGATCCCGCCGACGACTCTGCTGATTATAAACCTTTTGGGAGTGGTTGCGGGTATCTCTTACGCGCTC
AACAGTGGGTATCAGACTTGGGGACCTCTTTTTGGATAATCGATGAGAGCACCGGAGACTCGGCGGTTGTGGATCCTGTT
GATCCCGAGAAAGTGATTCAGTCGGCTGAGCAGCACAGTGCCAATATCAAGTTCGTTCTCACCACGCATCATCACTGGGA
TCATGCTGGTGGCAACGAGAAGATGAAGCAGTTGGTGCCTGGAATCAAAGTCTATGGAGGCTCTCTGGATAAGGTCAAGG
GATGCACTGATGCGGTTGATAATGGTGACACCTTGTCTTTGGGTCATGATGTTAACATATTAGCTCTTCACACCCCTTGT
CACACCAAGGGTCACATTAGTTACTATGTCACTGGCAAAGATGGAGAAACCCCAGCCGTGTTCACTGGAGATACACTTTT
CGTTGCTGGCTGTGGGAAGTTTTTCGAAGGGACAGCTGAACAGATGCATCAGTCCTTGTGTGTGACTCTGGCTTCACTAC
CTAAACCGACCCAGGTTTACTGCGGCCACGAGTACACAGTGAAGAACTTGGAGTTTGCTCTAACTGTGGAACCAAACAAC
GAGAAGATACAGCAGAAGCTGTCATGGGCCCGTCAACAGCGCCAAGCAAATCTTCCCACAATCCCTTCAACGCTAGAGGA
AGAGCTTGAAACAAACCCGTTTATGCGCGTTAATAATCCTGAGATACAGGAGAAACTTGGTTGCAAATCACCGATCGATA
CTCTCAGAGAAATCAGGAACAAGAAGGATCAGTGGAGGGGCTAA