Details for Kale Locus Bo5g137050

Position : C5 ( 5`- 42632366 .. 42633358 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137050

Protein [Map View]
MDPYTETGSVNFDSSLWPHASKSLPELLTEICQKAQRMLKLVKDGQPESTDIFLTLYQSLGESYNHMNQELLNGFLNFGF
KPSSSDKNSVSFADLSSFVSHSSPSLEFDLVSGLSYSSLKLNDEAEKKDQSAYMLADLEERNRLVGELESKLSDSSNKIM
TLERELDECHELLEVSEVEVSKLNEMLSERKTEKADDGGADLLLNTLRAELRSRDVQIEQMEEYLNQVCVKDTELLSDDE
SGTNKSVVEELKSRVEELENQVEKQSDVISEREEEKREAIRELCFSLDHYKSRYTEL

DNA
ATGGATCCTTACACAGAAACTGGATCAGTGAATTTTGATTCATCCTTGTGGCCACATGCTTCTAAGTCATTACCAGAACT
CTTAACAGAGATATGTCAGAAAGCCCAAAGAATGCTCAAACTGGTGAAAGATGGTCAACCTGAGTCAACAGATATTTTTC
TTACCTTGTATCAGTCTCTTGGTGAGTCTTACAACCATATGAACCAAGAGCTCCTCAACGGCTTCCTCAACTTTGGTTTT
AAACCTTCATCTTCAGACAAAAACAGTGTCTCATTTGCGGATTTGAGTTCCTTTGTATCTCATAGCTCTCCTTCTCTGGA
GTTTGATTTGGTGTCAGGACTCTCCTACTCATCTCTTAAGCTGAATGATGAGGCTGAGAAGAAGGACCAGTCTGCATATA
TGCTTGCTGATCTAGAAGAGAGAAACAGACTGGTGGGCGAGTTAGAGAGCAAGCTATCTGATTCAAGCAACAAAATCATG
ACTTTAGAACGAGAGCTCGATGAGTGCCATGAGCTTCTAGAGGTATCAGAAGTCGAGGTTTCGAAGCTGAATGAAATGTT
GAGTGAACGCAAGACCGAGAAAGCCGACGATGGTGGTGCTGACTTGTTGTTAAATACCCTGAGAGCAGAGCTGAGGTCAA
GAGATGTTCAGATCGAGCAAATGGAGGAGTATTTGAACCAGGTGTGTGTCAAAGACACTGAGCTTCTGTCTGATGATGAG
TCCGGAACCAACAAGAGTGTCGTGGAAGAATTGAAAAGTAGAGTTGAAGAGCTGGAGAATCAAGTGGAGAAGCAGAGTGA
TGTGATATCAGAAAGAGAGGAAGAGAAACGGGAAGCTATAAGAGAGCTCTGTTTCTCTCTTGATCATTACAAGAGCAGAT
ACACTGAACTT