Details for Kale Locus Bo5g137030

Position : C5 ( 5`- 42623079 .. 42624304 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137030

Protein [Map View]
MRVLDFPMDSSSDIEGDSEGRNEGGGSTSDYRLLGRQVTVHQFMGGGKAADLLLWRRRNHSLGVLVLSTAAWLTFELSGL
PILSVSSDVLLIGIIISFVHAQVSSFRNRQADSLPELVLSEEMVNSTAASFRVKLNHLLVMAHDVTVGNDFRLFFKVVIC
LWLLSAIGSYISFCTLVYIGTILSVTIPALYSKYQRKVDKCCGLIHRQLSHQYKLVDENVISKLSWSLSKDKDS*

DNA
ATGAGGGTTCTGGACTTTCCGATGGACAGTTCGAGTGACATCGAAGGTGATTCCGAGGGGAGAAATGAAGGAGGAGGATC
CACGTCGGATTATCGATTGCTGGGTCGGCAAGTTACGGTTCATCAGTTCATGGGCGGTGGCAAAGCTGCTGACTTGCTCT
TATGGAGGAGAAGAAACCATTCCTTGGGGGTTCTCGTTTTATCAACCGCGGCTTGGCTTACTTTCGAGCTTTCTGGATTG
CCTATCTTATCTGTTTCTTCAGATGTGTTACTGATTGGGATCATAATATCATTCGTCCATGCACAGGTTTCTTCTTTTAG
GAATAGACAGGCGGATTCGTTACCAGAGCTTGTTTTATCCGAGGAAATGGTTAATAGTACTGCAGCTTCCTTCCGTGTAA
AACTCAACCACTTGCTTGTAATGGCTCATGATGTTACAGTTGGCAACGATTTTCGCCTCTTCTTCAAGGTGGTGATTTGT
CTGTGGCTTCTCTCTGCCATTGGTAGCTATATTTCCTTCTGCACTCTTGTTTATATCGGGACCATCTTATCTGTTACAAT
ACCGGCTTTGTACAGCAAATATCAAAGGAAAGTAGACAAGTGTTGCGGGTTGATTCACAGGCAATTGTCTCATCAATACA
AGTTAGTTGACGAAAATGTTATAAGTAAACTCTCGTGGAGCTTATCCAAGGATAAAGACTCCTGA