Details for Kale Locus Bo5g137020

Position : C5 ( 5`- 42621366 .. 42622660 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137020

Protein [Map View]
MAIRSVLSTRTLSGLKETSSKLLGFRGIQTFTLPDLPYDYSALEPAISGEIMQIHHQKHHQTYVTNYNNALEQLDQAVNK
GDASTVVKLHSAIQFNGGGHVNHSIFWKNLAPVNQGGGEPPKGALGGAIDTHFGSLEGLVKKMSAEGAALQGSGWVWLGL
DKELKKLVVDTTANQDPLVTKGASLVPLVGIDVWEHAYYLQYKNVRPDYLKNVWKVINWKYASEVYESECK*

DNA
ATGGCGATTCGTTCTGTATTGAGCACAAGAACCCTATCCGGCCTAAAGGAGACGTCTTCTAAGCTTCTGGGTTTCAGAGG
AATCCAGACCTTCACGCTTCCTGATCTCCCTTATGATTACAGCGCGCTGGAGCCGGCGATTAGCGGCGAGATTATGCAGA
TTCACCACCAGAAGCATCACCAGACTTACGTCACTAATTACAACAATGCCCTCGAGCAGCTTGATCAGGCCGTGAACAAG
GGAGACGCTTCCACTGTCGTCAAGCTGCATAGCGCCATCCAGTTCAACGGCGGAGGTCATGTGAACCATTCGATTTTCTG
GAAGAATCTTGCTCCTGTCAATCAAGGTGGTGGAGAGCCACCGAAGGGAGCACTTGGTGGAGCCATTGACACTCACTTTG
GCTCTCTTGAAGGTTTGGTGAAAAAGATGAGTGCTGAAGGTGCTGCTCTGCAAGGCTCGGGATGGGTGTGGCTCGGTTTA
GACAAAGAACTTAAGAAGCTTGTGGTTGACACAACCGCCAATCAGGATCCACTTGTGACAAAAGGAGCAAGCTTGGTTCC
TCTGGTGGGTATAGATGTTTGGGAACACGCCTACTACTTGCAGTACAAGAATGTGAGGCCGGATTATCTGAAGAACGTGT
GGAAAGTGATCAACTGGAAATACGCAAGCGAAGTTTATGAGAGTGAATGCAAGTGA