Details for Kale Locus Bo5g137000

Position : C5 ( 5`- 42615442 .. 42617005 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g137000

Protein [Map View]
MSVVGSKSCIFSLSSHFRENDKSSRLNSINKPSIDPRRFPRNLGVTCKISGRNGAEEIPGKNGVSLSSKNKMEDYNTAMK
RLMRSPYEYHHDLGMNYTLIRDELIVGSQPQKPEDIDHLKKEENVAYILNLQQDKDIEYWGIDLDSIVKRCKDLGIRHMR
RPAKDFDPLSLRSQLPKAVSSLEWAVSEGKGRVYVHCTAGLGRAPAVSIAYMYWFCDMNLNTAYDALVSKRPCGPNKGAI
RGATYDLAKNDPWKKPFESLPENAFEDIADWERKLIQERVRANRGT*

DNA
ATGAGTGTCGTTGGAAGCAAGAGCTGTATTTTCTCCCTTTCGAGCCACTTCCGAGAAAATGACAAATCTTCCCGGCTCAA
TTCGATTAATAAACCATCGATTGATCCAAGAAGATTCCCAAGAAATCTGGGAGTTACCTGCAAAATCTCAGGGAGAAATG
GAGCCGAGGAGATTCCAGGGAAGAATGGGGTTTCTCTCAGCTCCAAGAACAAGATGGAAGATTACAATACAGCTATGAAG
AGACTGATGAGGAGCCCATATGAATATCATCATGATCTCGGCATGAACTATACATTGATAAGAGACGAACTGATCGTTGG
GTCACAGCCACAGAAGCCTGAGGATATAGACCACTTGAAGAAAGAAGAGAACGTTGCTTACATACTTAACTTGCAACAAG
ACAAAGACATCGAGTATTGGGGAATCGATCTTGACTCCATTGTCAAAAGATGTAAAGACCTCGGAATCCGTCACATGAGA
AGGCCCGCTAAAGACTTTGATCCACTTTCGTTGAGAAGCCAGCTTCCGAAAGCTGTGTCTTCTTTGGAATGGGCAGTGTC
AGAAGGTAAAGGAAGAGTTTACGTGCATTGCACAGCCGGATTGGGAAGAGCTCCTGCGGTTTCTATTGCTTATATGTATT
GGTTCTGTGACATGAACCTGAACACCGCTTATGACGCATTGGTGTCAAAGCGTCCGTGTGGGCCTAACAAAGGAGCTATA
CGTGGGGCTACATATGATCTGGCTAAGAATGATCCGTGGAAAAAGCCCTTTGAGAGTCTCCCTGAGAACGCATTCGAGGA
TATTGCAGATTGGGAGAGGAAGCTGATTCAAGAACGTGTTAGGGCCAACCGTGGAACCTGA