Details for Kale Locus Bo5g136990

Position : C5 ( 5`- 42611143 .. 42613829 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136990

Protein [Map View]
MEQELPFSTRTKPKLLNRLNAYVGSSRVGKRFKLAERNSTFTTELRAGTATFLTMAYILAVNASILSDSGGTCSVSDCVP
LCSNPTIPPSQCTGPGVRLIQPDVTCKFDPVNPGYASCVEGIRKDLIVATVAASLIGCVIMGLMANLPLALAPGMGTNAY
FAYTVVGFHGSGSISYQTALAAVFIEGLIFLFISAVGFRAKLAKLVPKPVRISSSAGIGLFLAFIGLQNNQGLGLVGYSP
STLVTLAACPTTSRASLAPVITSANGTVSLIPGGSVSGDIMCLHGRMESPTFWLGIVGFVIIAYCLVKNVKGAMIYGIVF
VTAVSWFRNTEVTAFPNNPAGDAAHEYFKKVVDVHVIKHTAGALSFSGISEGHFWEALVTFLYVDILDTTGTLYSMARFA
GFVDERGDFAGQYFAFMSDASAIVIGSLLGTSPVTVFIESSTGIREGGRTGLTAITVAVYFLLAMFFTPLLASIPAWAVG
PPLILVGVMMMKSVTEIDWGDMREAIPAFVTMIMMPLTYSVAYGLIGGIGTYVVLHLWDWGEEGMVRLGFLKRKVEEEDN
SNGVAKISETHTLKHCKIRNSTLQHRQINKNEIQTEAAQKFLVVTLNTLAIRGAHYNFVKGTFNLWELDFKITPAYAFS*

DNA
ATGGAGCAAGAACTACCTTTTAGTACCAGAACCAAGCCCAAGCTACTAAACCGACTCAACGCTTACGTCGGTTCAAGCCG
AGTTGGCAAACGGTTCAAACTCGCCGAACGGAATTCAACTTTCACGACGGAGCTCCGCGCCGGTACGGCGACTTTTCTCA
CCATGGCCTACATCCTCGCCGTGAACGCCTCCATCTTATCTGACTCCGGCGGCACCTGCTCTGTTTCCGACTGCGTTCCC
CTCTGCTCAAACCCAACGATCCCACCTTCCCAGTGTACCGGACCGGGTGTCCGACTCATCCAACCGGACGTAACGTGTAA
ATTCGACCCGGTTAACCCCGGTTACGCATCGTGCGTGGAAGGAATCCGAAAGGATCTAATCGTCGCCACCGTGGCGGCGT
CTCTGATCGGGTGCGTGATCATGGGGCTGATGGCGAATCTCCCTCTAGCTCTAGCTCCGGGGATGGGAACAAACGCGTAC
TTCGCTTACACCGTCGTCGGTTTCCACGGATCCGGTTCAATCTCGTACCAAACCGCTCTCGCCGCGGTTTTCATCGAGGG
ATTAATATTCCTCTTCATCTCCGCCGTAGGCTTCAGAGCGAAGCTAGCGAAACTCGTCCCTAAACCGGTCAGAATCAGCT
CCTCCGCCGGAATCGGACTCTTCCTCGCCTTCATCGGTTTACAGAACAATCAAGGACTCGGTTTAGTCGGTTACAGCCCT
TCCACTCTCGTCACTCTCGCCGCGTGTCCAACCACGTCACGAGCTTCGTTAGCTCCCGTTATAACGTCGGCTAACGGAAC
CGTCAGTTTGATCCCCGGAGGATCCGTTTCGGGAGATATCATGTGCCTCCACGGACGCATGGAGAGTCCCACCTTCTGGC
TAGGCATCGTCGGGTTCGTGATCATCGCCTACTGTCTGGTGAAGAACGTGAAAGGAGCGATGATCTACGGGATCGTCTTC
GTAACGGCCGTCTCGTGGTTCCGTAACACCGAGGTAACGGCGTTTCCCAACAACCCCGCGGGAGACGCGGCTCACGAGTA
TTTCAAAAAGGTCGTTGACGTCCACGTCATCAAGCACACGGCGGGAGCGTTGAGCTTCTCGGGGATAAGCGAAGGGCATT
TCTGGGAAGCGTTAGTGACTTTCCTCTACGTGGATATTTTGGACACGACGGGGACGCTCTACTCCATGGCGAGGTTCGCC
GGGTTCGTCGACGAGAGGGGAGACTTCGCGGGGCAGTACTTCGCGTTCATGTCCGACGCGTCCGCGATCGTGATCGGATC
GCTTCTCGGAACGTCTCCGGTGACGGTTTTTATAGAGTCGTCGACGGGGATACGGGAGGGAGGGAGGACGGGGCTGACGG
CGATCACGGTGGCGGTTTATTTCTTACTGGCGATGTTCTTCACGCCGCTGCTGGCTTCGATTCCGGCGTGGGCGGTCGGG
CCGCCGTTGATACTGGTGGGGGTGATGATGATGAAGTCGGTGACGGAGATCGATTGGGGGGATATGAGGGAGGCGATTCC
GGCGTTCGTGACGATGATTATGATGCCGTTGACGTACTCGGTGGCGTACGGGTTGATCGGAGGGATAGGGACGTATGTGG
TGTTGCATCTGTGGGATTGGGGAGAGGAAGGGATGGTGAGATTAGGGTTTTTGAAAAGGAAAGTTGAAGAAGAGGATAAC
AGCAATGGAGTTGCCAAAATTAGCGAGACTCATACGTTGAAGCACTGTAAAATCAGGAACTCCACTCTGCAACACAGACA
AATCAATAAGAATGAAATTCAAACCGAAGCAGCGCAGAAGTTTCTTGTTGTTACCTTGAACACGCTTGCTATAAGAGGAG
CTCACTACAATTTCGTCAAAGGCACATTTAATCTATGGGAGCTCGATTTCAAGATCACTCCTGCTTATGCCTTCTCTTGA