Details for Kale Locus Bo5g136960

Position : C5 ( 5`- 42552835 .. 42554403 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136960

Protein [Map View]
MGSNPEITSLKKSNALCPLDVSSSFSSRRTLISSDGNKLKSWSSSVTTVLPSPSAKFMKMAEQRDEVSRSVKTSSIRERI
SGVLHRKIDWTSLANMGKEWIRNPINMALFLWILAVAVSGAILFMVMTGMLNHALPKKSERDAWFEVNNQILNGLFTLMC
LYQHPKRFYHLVLLCRWGRDDVAKLRKVYCKNGSYKPHEWMHVMVVVLLLHLNCFAQYALCGLNVGYRRSERPPIGVAVC
ISAAIGAPAAAALYTMLSPLGRDYDDDEENQLQGSVNSRVSLERRYSFASNGMVPVSDPQWSGGVLDIWDDISLAYLSLF
CTFCVFGWNMERVGFGNMYVHIATFILFCLAPFFIFTLAAVNIDDETVREALGVSGILLCVFGLLYGGFWRIQMRKRFKL
PSYKFCFGNAAVADCTLWLFCCWCSLAQEVRTADSYEIVEDKFCQRVQQEKSLVSPLPREDGVFDPKVGIGSSPRNVSGA
NTPSRFWKEVHSPNVQTPRGNGEGNSEVVLTPPSPLSIRREA*

DNA
ATGGGATCGAACCCCGAGATCACCTCTCTCAAAAAAAGCAACGCTCTCTGCCCTCTCGATGTCTCATCCTCCTTCTCCTC
CCGAAGAACACTCATCTCCTCCGACGGCAACAAACTGAAAAGCTGGTCCTCCTCAGTCACCACGGTCCTCCCTTCCCCGT
CAGCTAAATTCATGAAAATGGCCGAGCAGAGAGACGAGGTCTCCCGCTCGGTCAAAACCTCGAGCATCCGGGAACGGATC
AGCGGCGTGCTCCACCGGAAAATCGACTGGACATCTCTAGCCAACATGGGGAAAGAATGGATCAGAAACCCTATCAACAT
GGCCCTCTTCCTCTGGATCCTCGCCGTCGCCGTCTCCGGAGCCATCCTCTTCATGGTCATGACCGGGATGCTGAACCACG
CTCTCCCCAAGAAGTCAGAGAGAGACGCGTGGTTCGAAGTCAACAACCAGATCCTCAACGGTCTGTTCACGCTGATGTGT
CTCTACCAGCATCCGAAGCGGTTTTACCACTTGGTGCTTCTCTGCAGGTGGGGGCGTGATGACGTGGCTAAGCTTAGGAA
GGTTTATTGCAAGAACGGGAGTTATAAGCCTCACGAGTGGATGCATGTGATGGTCGTTGTGCTTTTGCTTCATTTGAATT
GTTTCGCTCAGTACGCGCTTTGTGGTCTTAACGTTGGTTACAGAAGGTCTGAGAGGCCGCCTATTGGTGTCGCTGTGTGT
ATCTCCGCTGCTATTGGTGCTCCTGCTGCCGCGGCGTTGTACACTATGCTTAGTCCCCTTGGGAGAGATTACGATGATGA
TGAGGAGAATCAACTCCAAGGGTCTGTGAATAGCAGAGTTAGTTTAGAGAGGAGGTACTCGTTTGCTTCAAATGGGATGG
TTCCTGTGAGTGATCCTCAGTGGAGCGGTGGAGTTTTGGATATTTGGGATGATATCTCGTTAGCTTATCTTTCTCTGTTT
TGTACTTTTTGTGTGTTTGGATGGAACATGGAGAGAGTTGGGTTTGGGAACATGTATGTTCACATTGCCACGTTTATTCT
CTTTTGCTTAGCGCCTTTCTTTATATTCACCTTAGCTGCGGTTAACATCGATGACGAGACGGTTAGGGAGGCGCTTGGAG
TATCCGGAATCCTTCTCTGTGTGTTTGGTTTGCTCTACGGTGGATTCTGGAGGATCCAGATGAGGAAGAGATTCAAGCTG
CCGAGTTATAAGTTCTGCTTCGGTAACGCTGCCGTTGCTGATTGTACTCTTTGGCTGTTCTGTTGCTGGTGCTCCTTGGC
GCAGGAAGTTAGGACTGCGGACTCTTATGAGATTGTGGAGGATAAGTTCTGTCAGAGAGTGCAGCAAGAGAAGAGTTTGG
TGTCTCCTCTGCCTCGTGAAGACGGTGTGTTTGATCCTAAGGTTGGTATTGGGAGCTCGCCGAGGAACGTGAGCGGAGCC
AACACTCCGAGTAGGTTTTGGAAAGAGGTGCATAGTCCGAATGTGCAGACGCCTAGAGGGAATGGTGAAGGGAACAGCGA
GGTTGTTCTGACTCCGCCTTCTCCTTTGTCTATACGCAGAGAAGCTTGA