Details for Kale Locus Bo5g136950

Position : C5 ( 5`- 42550695 .. 42551773 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136950

Protein [Map View]
MATLLYMNTLHDMCNELDTLADSETKNRDVVLKLYDALRSRDVDSVHRTLTPDLDYWFHGPPPHQFLMRTLTGVSPPFEF
SPLSVVSFGSTVIAEGCDAASSVSWIHAWTVSHGVITQVREYSNTSLTVTRIGSVVSGRSAEIRASHCPSVWESKFSGRA
GKSVPGLVLAI*

DNA
ATGGCCACTCTGCTTTACATGAACACTTTGCATGACATGTGTAATGAACTGGATACTCTGGCGGATTCTGAGACCAAGAA
CCGAGACGTGGTTCTGAAGCTGTATGACGCCCTGAGATCTCGCGACGTCGACTCCGTTCACCGGACCCTAACCCCGGACC
TCGACTACTGGTTCCACGGCCCTCCGCCGCACCAGTTTTTGATGCGCACGCTCACCGGCGTCTCTCCGCCGTTTGAATTC
TCGCCTCTCTCCGTCGTCTCCTTCGGATCCACCGTCATTGCCGAGGGCTGCGACGCCGCCAGCTCCGTCTCCTGGATCCA
CGCCTGGACCGTGTCGCATGGGGTAATCACTCAGGTGAGGGAGTACTCGAACACCTCGCTCACGGTTACGCGGATCGGTA
GCGTCGTCTCCGGGCGCTCTGCGGAGATCAGGGCGTCGCATTGCCCCTCCGTGTGGGAAAGCAAATTCTCGGGTCGGGCT
GGAAAATCCGTCCCGGGTCTGGTTCTTGCGATTTGA