Details for Kale Locus Bo5g136940

Position : C5 ( 5`- 42538012 .. 42540823 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136940

Protein [Map View]
MGAGRKTETYKQEDVQNLYGTMSVRKLQKGDLCGVIFGCKFSTIKECHAKNLFGLPGPHMAYIKNIEPGLTLFLFNYSDR
TLHGVFEAASEGKLNIDPKAWSHNGTDPSPYPAQVKVRVRVKCEPLSEETFGPVIADNYKDEKIFWFELDRVQTNKLLRL
FKPSPYVRAPPSTSKHVVASPSSSSRNAIPASSLVEIGDSGGAPRVDKWSSLFKQDSKDGKTKECEVAQKHVSQSGPTYS
SVLRNANSESSARREAPSQASKGVLSSRQDVIVNTCEQQSFQPPQNGTSAKAKNIIGPSTGTSAEGAYSEIDWDAASNFH
AHLKGLNMILEDTRDKDGYKSFDKGNNTGFASSSSMMQNDWEDERVSWEYEEENNIDKSSCGSSYVTAMSGDAFEDNGEE
KEKLCMDVLSEIWAEVKEMKQTQMKQAEYMISLQMDQLESRKEILRLKGLYGSS*

DNA
ATGGGTGCAGGGAGGAAGACAGAGACCTATAAGCAAGAGGATGTCCAAAATCTATATGGAACTATGTCTGTAAGGAAGCT
TCAGAAAGGAGATCTCTGCGGTGTTATATTTGGATGCAAGTTCAGCACTATCAAAGAGTGTCACGCTAAGAACTTGTTTG
GCTTACCAGGCCCTCACATGGCTTACATCAAGAACATTGAACCTGGTCTGACGCTGTTCTTGTTCAACTACAGTGATAGA
ACACTTCACGGCGTCTTTGAAGCCGCGAGTGAAGGAAAGCTGAACATTGATCCCAAAGCTTGGTCTCATAATGGTACAGA
TCCAAGTCCGTACCCTGCTCAGGTAAAGGTACGTGTCCGAGTGAAGTGTGAGCCGTTGTCTGAAGAAACGTTTGGACCAG
TAATTGCTGATAATTACAAGGATGAGAAGATCTTTTGGTTTGAACTTGACCGAGTTCAGACAAACAAGCTGCTACGTTTG
TTTAAACCATCACCATATGTAAGGGCACCACCATCAACATCCAAACATGTTGTTGCATCACCATCATCATCATCCAGAAA
CGCTATTCCGGCTTCTTCTCTTGTGGAGATAGGTGACTCAGGAGGAGCGCCACGTGTTGATAAGTGGAGCAGTCTTTTTA
AACAAGACTCAAAAGATGGAAAAACTAAAGAATGTGAAGTAGCTCAAAAACATGTGTCACAATCTGGTCCAACTTACTCA
TCGGTTCTCAGAAATGCGAACAGTGAATCTTCAGCTAGACGTGAAGCTCCATCACAAGCAAGTAAAGGAGTTTTGTCCTC
ACGCCAAGATGTCATAGTCAACACTTGCGAACAACAAAGTTTCCAACCACCGCAAAATGGGACTTCTGCTAAGGCTAAGA
ATATAATAGGACCTAGCACGGGAACTTCTGCCGAGGGTGCATATTCAGAGATTGACTGGGATGCTGCATCAAATTTTCAT
GCCCATCTGAAAGGACTCAACATGATTTTGGAGGATACTAGGGATAAGGATGGTTACAAGAGTTTTGACAAGGGTAACAA
CACAGGATTTGCTTCTTCTTCTTCAATGATGCAAAATGATTGGGAAGATGAGAGGGTGTCTTGGGAATATGAGGAAGAGA
ATAATATAGATAAATCATCGTGTGGGTCCTCGTACGTTACCGCCATGTCAGGGGACGCATTTGAAGACAATGGAGAGGAG
AAAGAGAAGCTTTGTATGGATGTCTTGAGTGAGATATGGGCGGAAGTGAAAGAGATGAAGCAAACTCAGATGAAACAAGC
TGAGTATATGATCTCGTTGCAGATGGATCAGCTTGAGTCAAGAAAAGAGATACTTCGACTGAAAGGGCTATATGGAAGTT
CTTAA