Details for Kale Locus Bo5g136910

Position : C5 ( 5`- 42530820 .. 42532332 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136910

Protein [Map View]
MLLKASPAFSILNSGVGDLFPPSNVLFPSTACRGSRLSVRAAKGTSTKSLTGVVFEPFEEVKKDMDLLVPTTPLASLARH
KFSDESESAVNEQINVEYNVSYIYHALYAYFDRDNVGLKGFANFFKDSSIEERGHAEKFMEYQNKRGGRVKLQSILMPFS
EFDHEEKGDALYAMELALSLEKLTNEKLLKLQSVGVKNNDVQLVDFVESEFLGEQVEAIKKISEYVAQLRRIGKGHGVWH
FDQMLLDEQVLLHAG*

DNA
ATGTTGCTTAAGGCTTCTCCCGCGTTTTCTATCTTGAACTCCGGTGTCGGAGATCTCTTTCCACCGTCGAACGTTCTGTT
TCCTTCCACCGCGTGCCGTGGATCAAGGTTGTCTGTTCGGGCGGCGAAAGGAACGAGCACAAAGTCGTTAACCGGAGTTG
TGTTCGAGCCTTTTGAGGAAGTGAAGAAAGACATGGATCTGCTTGTTCCCACCACACCTCTGGCTTCCCTCGCACGCCAC
AAGTTCTCGGACGAGTCTGAATCTGCGGTTAACGAACAGATCAATGTGGAGTACAATGTCTCCTACATCTATCATGCCTT
GTATGCCTACTTTGACCGAGATAATGTTGGCTTGAAAGGTTTCGCTAATTTCTTCAAAGATTCGTCTATTGAAGAACGGG
GTCACGCTGAGAAGTTTATGGAGTACCAGAACAAGCGTGGTGGGAGAGTGAAGCTGCAGTCTATTCTGATGCCATTCTCT
GAGTTTGATCACGAGGAGAAAGGTGATGCATTATATGCTATGGAGCTTGCACTATCTCTGGAGAAACTTACAAATGAAAA
GCTTCTCAAGTTGCAAAGTGTGGGTGTGAAAAACAACGATGTTCAGCTGGTTGATTTTGTCGAATCTGAGTTTCTAGGAG
AGCAGGTCGAAGCTATCAAGAAAATCTCAGAGTACGTTGCCCAGCTAAGAAGAATTGGAAAGGGTCATGGGGTGTGGCAT
TTTGACCAAATGCTTCTGGATGAGCAAGTGCTTCTGCATGCGGGTTAA