Details for Kale Locus Bo5g136870

Position : C5 ( 5`- 42518609 .. 42520835 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136870

Protein [Map View]
MANPTENPPNREPKYELDIDEGELEEAEDEDDTASNPRTESLFRRMRSAPVPVRVHDVIVKGNEKTKDHIIEAEVEAVIR
EANTLQELLEASRVANSNLRALDIFDSVNITLDSGPPELPGTTNVVIEVVESKNPLTGQIGAYTKAEAKSSSVEASLKYK
NIFGYGDIWDGSMVYGLDSSAEVGLGMYLPRFKALPTPFSSRLYLSTQDWLKFSSYEERSLGLSLGLLSSKYHELVYTVA
WRSLIDPSRLASESIRRQLGHSLLSALKYTFKYDQRDSYLRPTSGYAFSSTSQVGGLAPDSRSLRFFKQEIDLRCAVPLG
FYAAALNFGVSGGVTFPWGSGYKNRASSVPERFFLGGNSSPVCSLSGPSALWGFSTRGLGPNEARRRGDVERDFVGGDAA
VTAFADLSFDLPVRWLRERGVHGHVFACAGNTAKLTENEFRNFSGPKFLETFRTSVGAGIVLPVSLFRMEINYCHIVKKQ
EHDRAKSGFFLTFSA*

DNA
ATGGCGAACCCGACGGAAAATCCACCAAACCGAGAACCAAAATACGAACTGGACATCGACGAAGGAGAACTAGAAGAGGC
GGAAGACGAAGATGATACAGCATCCAATCCTCGAACGGAATCGCTCTTCCGTCGGATGAGATCCGCTCCTGTGCCTGTGC
GCGTGCACGACGTGATCGTCAAAGGAAACGAGAAGACCAAGGACCACATCATCGAGGCGGAAGTGGAAGCTGTGATCAGG
GAAGCGAACACGCTGCAGGAGCTTCTAGAAGCCTCTAGGGTTGCCAATTCGAATCTCCGAGCGCTTGATATCTTCGATTC
CGTCAACATTACGCTCGATTCCGGCCCTCCTGAGCTTCCCGGTACAACCAATGTGGTTATCGAAGTCGTCGAGAGCAAAA
ACCCTCTCACCGGCCAAATCGGCGCCTACACTAAAGCTGAGGCCAAATCATCAAGCGTTGAAGCATCTTTGAAGTACAAG
AACATTTTCGGGTATGGAGATATATGGGACGGGTCTATGGTCTATGGACTTGACAGCTCTGCTGAGGTTGGCTTGGGGAT
GTATCTCCCTAGGTTCAAAGCACTTCCCACTCCTTTTAGCTCTCGTCTCTACCTCTCGACTCAAGACTGGCTTAAGTTTT
CTTCTTACGAAGAACGCTCTCTCGGACTTTCCCTCGGGCTTCTCTCTAGCAAGTATCACGAGCTTGTCTACACTGTCGCG
TGGCGTAGCCTCATAGACCCGTCTCGGTTGGCTTCAGAGTCGATAAGGAGGCAACTGGGACATAGTCTGCTTTCTGCGTT
GAAGTATACTTTTAAGTACGACCAGAGAGACTCTTACTTGAGGCCAACGAGTGGGTACGCTTTCAGTTCTACTTCTCAGG
TCGGTGGTCTTGCCCCTGATAGCAGAAGCCTACGGTTTTTCAAGCAGGAGATTGATCTTCGGTGTGCTGTTCCTTTAGGG
TTCTACGCAGCTGCTCTGAACTTTGGTGTGTCTGGGGGTGTCACGTTTCCGTGGGGAAGCGGATACAAGAACCGAGCCTC
CTCTGTGCCGGAGAGGTTCTTCTTGGGTGGGAACTCATCTCCTGTATGCTCTTTGAGTGGGCCGTCTGCGCTGTGGGGGT
TCAGTACCAGAGGACTCGGTCCCAACGAGGCGAGGAGGAGAGGAGATGTCGAAAGAGATTTTGTTGGAGGGGACGCTGCG
GTGACTGCGTTTGCGGATCTCTCGTTTGATTTGCCAGTGAGGTGGTTGAGAGAGAGAGGAGTCCACGGGCATGTGTTTGC
ATGTGCGGGGAATACGGCAAAGCTAACAGAGAATGAGTTTAGAAACTTCAGTGGTCCGAAGTTCTTGGAGACGTTTAGAA
CTTCAGTTGGTGCTGGAATCGTATTGCCAGTTAGTCTCTTCCGTATGGAGATTAACTACTGCCATATAGTGAAGAAACAA
GAACACGATCGAGCAAAATCTGGTTTTTTCCTGACATTCTCGGCCTGA