Details for Kale Locus Bo5g136860

Position : C5 ( 5`- 42517048 .. 42517563 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136860

Protein [Map View]
MRGHEPRSSSSCAACKLLKRRCTPTCIFAPHFRSSDQITFAKVHKVFGASNVSKLLSEVPEEQRQETVNSLAYEADVRLK
DPVYGCIGAIASLQKKMLELQHDIAVARNRLLAHNAAGGVNNNNSHVLLSPLDDSPQLAAFLDLVPYSDLMLLDGSGLDA
YLFDIGQPPFV*

DNA
ATGAGAGGGCATGAGCCACGATCAAGCTCCTCTTGTGCAGCTTGCAAGCTCTTGAAGAGAAGATGCACACCCACTTGCAT
CTTTGCTCCTCATTTCCGCTCAAGCGACCAGATAACTTTCGCCAAAGTCCATAAAGTCTTTGGAGCCAGCAACGTCAGTA
AGCTACTCAGCGAGGTTCCTGAAGAGCAGAGACAAGAGACCGTTAACTCCTTGGCTTATGAAGCTGACGTTCGTCTCAAG
GATCCTGTCTACGGTTGTATTGGAGCCATAGCTTCTCTGCAGAAGAAGATGCTTGAGCTTCAACATGATATAGCCGTTGC
TCGCAATCGGCTACTTGCCCATAATGCTGCTGGTGGTGTCAACAACAACAACAGCCACGTGTTGTTGTCTCCTTTGGATG
ATTCTCCTCAGCTTGCTGCTTTTCTTGATCTTGTGCCTTATAGTGACTTGATGCTGCTTGATGGGTCTGGTCTTGATGCT
TACTTGTTTGATATTGGACAGCCTCCTTTTGTATAG