Details for Kale Locus Bo5g136850

Position : C5 ( 5`- 42515203 .. 42516176 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136850

Protein [Map View]
MDTTPETQSKSQSQSGGGGGSHRLPPGREDWWSEDATATLIEAWGDRYVHLSRGNLRQNDWKEVADAVNSRHGNGRPKTD
VQCKNRIDTLKKKYKTEKAKPSSSWCFFERLDFLIGPVALKKSTGGAGALKSPLTKPISSESSLDDDDDDDDDDDVEGDW
GFVARKHRRVEDEDLCPDPREGSSCRELARAILKLGEVYERIESAKQGMMIELEKQRMEAAKEIELQRMNMLMDMQMELE
KSKLGKRRAAASGKKL*

DNA
ATGGACACGACGCCGGAGACTCAATCGAAATCCCAATCGCAGAGCGGCGGCGGCGGCGGATCGCACCGTCTCCCGCCGGG
ACGCGAGGACTGGTGGAGCGAGGACGCGACGGCGACGCTGATCGAAGCCTGGGGAGACCGATACGTCCACCTCAGCCGCG
GAAACCTCCGGCAGAACGACTGGAAAGAAGTCGCCGACGCCGTCAATTCTCGCCACGGCAACGGCCGGCCGAAGACCGAC
GTGCAGTGCAAGAACCGGATCGACACGCTGAAGAAGAAGTACAAGACGGAGAAGGCGAAGCCTTCTTCGTCTTGGTGCTT
CTTCGAGAGGCTCGATTTCCTAATCGGCCCCGTCGCGCTGAAGAAATCCACCGGCGGCGCCGGAGCTCTGAAGTCGCCGT
TGACGAAGCCTATTTCAAGTGAAAGCTCTCTTGACGACGATGACGACGATGATGATGATGATGACGTGGAGGGTGATTGG
GGGTTTGTGGCGAGGAAGCATCGGAGAGTGGAGGATGAAGATCTCTGTCCAGATCCGAGGGAAGGATCGTCGTGTAGGGA
GCTAGCGAGAGCGATTCTGAAGCTAGGAGAGGTGTACGAGAGGATCGAAAGTGCGAAGCAGGGGATGATGATTGAGTTGG
AGAAGCAGAGGATGGAAGCTGCCAAGGAGATTGAGTTACAACGTATGAACATGTTGATGGATATGCAGATGGAGCTTGAG
AAGTCTAAGCTTGGGAAACGTAGAGCTGCTGCTTCAGGTAAGAAGTTGTAG