Details for Kale Locus Bo5g136840

Position : C5 ( 5`- 42511725 .. 42512228 -3` )
Annotation :
External links : CoGe
PGDD synteny : Bo5g136840

Protein [Map View]
MTSSSPSPRASMLLYWHENQYDDRNFQIHGQTVFFVVALFSVVLFFALLTLYIHRSCLARDPTDFHAPSPPFTLYVSGGL
DPAEIRSLPVVLCRREAEEEQRECCICLGGLEEGEKMKVLPLCRHCYHCECVDRWLMTESSCPLCRVSIRVDSSVSLPVH
GNETTTC*

DNA
ATGACGTCATCATCACCGTCTCCGAGAGCCTCTATGCTTCTGTACTGGCACGAGAACCAGTACGACGACCGTAACTTCCA
GATTCACGGCCAGACAGTTTTCTTCGTCGTGGCTCTGTTCTCCGTCGTCCTCTTCTTCGCGTTACTCACTCTCTACATCC
ACAGGAGCTGCCTCGCTCGCGATCCCACCGACTTCCACGCGCCGTCTCCTCCGTTTACGCTGTACGTCAGCGGAGGTCTT
GACCCGGCGGAGATTCGGAGTTTGCCGGTGGTGCTCTGCCGGAGAGAAGCTGAGGAGGAACAGAGGGAGTGTTGTATATG
CCTCGGTGGTTTAGAAGAAGGGGAGAAGATGAAAGTGCTTCCTCTGTGTCGCCACTGTTACCACTGCGAATGTGTGGACC
GGTGGCTTATGACCGAGTCGAGTTGTCCGCTGTGCCGAGTCTCGATCAGAGTCGACTCGTCCGTGTCGTTGCCAGTGCAT
GGGAATGAAACGACGACGTGTTGA